SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL110C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL110C
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-20
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 
Weak hits

Sequence:  YKL110C
Domain Number - Region: 189-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0769
Family WD40-repeat 0.012
Further Details:      
 

Protein sequence

External link(s) Locus: YKL110C   Protein: S000001593
Sequence length 313
Comment KTI12 SGDID:S000001593, Chr XI from 229524-228583, reverse complement, Verified ORF, "Protein that plays a role, with Elongator complex, in modification of wobble nucleosides in tRNA; involved in sensitivity to G1 arrest induced by zymocin; interacts with chromatin throughout the genome; also interacts with Cdc19p"
Sequence
MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGIKHSDYITSQD
ERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCEVKNLSTTFCVIQTLCPPETI
FEWNKTSNPNPWEPELLNQLIQRYEEPNSSNRWDSPLFAILTPQDNITDYIDDICKVVFQ
TSKSAKNSGHNDPLSKGLQKPNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSI
GGVSNGTRVIVSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI
GPLFADYLNKNLN
Download sequence
Identical sequences P34253
YKL110C YKL110C YKL110C 4932.YKL110C YKL110C YKL110C

Jump to [ Top of page · Domain architecture · Domain assignment details ]