SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL110C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL110C
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-20
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 
Weak hits

Sequence:  YKL110C
Domain Number - Region: 189-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0769
Family WD40-repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.39 26.96
microtubule associated complex 2.062 25.24
cilium 1.637 21.89
ciliary part 1.792 20.48
chromosomal part 1.471 20.12
transporter complex 1.657 19
midbody 2.148 18.28
side of membrane 1.57 16.03
endosome 1.318 12.91
nucleoplasm part 1.424 12.35

Protein sequence

External link(s) Locus: YKL110C   Protein: S000001593
Sequence length 313
Comment KTI12 SGDID:S000001593, Chr XI from 229524-228583, reverse complement, Verified ORF, "Protein that plays a role, with Elongator complex, in modification of wobble nucleosides in tRNA; involved in sensitivity to G1 arrest induced by zymocin; interacts with chromatin throughout the genome; also interacts with Cdc19p"
Sequence
MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGIKHSDYITSQD
ERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCEVKNLSTTFCVIQTLCPPETI
FEWNKTSNPNPWEPELLNQLIQRYEEPNSSNRWDSPLFAILTPQDNITDYIDDICKVVFQ
TSKSAKNSGHNDPLSKGLQKPNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSI
GGVSNGTRVIVSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI
GPLFADYLNKNLN
Download sequence
Identical sequences N1NZR8 P34253
YKL110C YKL110C YKL110C 4932.YKL110C YKL110C YKL110C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]