SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL119C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL119C
Domain Number - Region: 95-133
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0693
Family MW0975(SA0943)-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL119C   Protein: S000001602
Sequence length 215
Comment VPH2 SGDID:S000001602, Chr XI from 218861-218214, reverse complement, Verified ORF, "Integral membrane protein required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the endoplasmic reticulum (ER)"
Sequence
MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC
SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD
ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV
ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL
Download sequence
Identical sequences G2WHR7 N1P0S1 P32341
YKL119C YKL119C YKL119C 4932.YKL119C YKL119C YKL119C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]