SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL119C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL119C
Domain Number - Region: 95-133
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0693
Family MW0975(SA0943)-like 0.015
Further Details:      
 

Protein sequence

External link(s) Locus: YKL119C   Protein: S000001602
Sequence length 215
Comment VPH2 SGDID:S000001602, Chr XI from 218861-218214, reverse complement, Verified ORF, "Integral membrane protein required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the endoplasmic reticulum (ER)"
Sequence
MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC
SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD
ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV
ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL
Download sequence
Identical sequences G2WHR7 P32341
YKL119C YKL119C 4932.YKL119C YKL119C YKL119C YKL119C

Jump to [ Top of page · Domain architecture · Domain assignment details ]