SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL156C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL156C-A   Protein: S000028668
Sequence length 38
Comment YKL156C-A SGDID:S000028668, Chr XI from 159096-158980, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; completely overlaps the verified gene RPS27A; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MFKQPGHLTSRKYDLGPWTNVFNLCFLASEAAVGCNKS
Download sequence
Identical sequences C8ZC19 Q8TGN0
YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A 4932.YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]