SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL156C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YKL156C-A   Protein: S000028668
Sequence length 38
Comment YKL156C-A SGDID:S000028668, Chr XI from 159096-158980, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; completely overlaps the verified gene RPS27A; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MFKQPGHLTSRKYDLGPWTNVFNLCFLASEAAVGCNKS
Download sequence
Identical sequences C8ZC19 Q8TGN0
YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A 4932.YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A YKL156C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]