SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL186C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL186C
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily NTF2-like 4.82e-65
Family NTF2-like 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.424 41.64
nuclear envelope 1.869 15.23
mitochondrial envelope 1.593 11.56
organelle inner membrane 1.692 5.91
nuclear body 1.842 5.78
inner mitochondrial membrane protein complex 1.909 4.03
Molecular Function IC (bits) H-Score
GTPase binding 1.627 16.88
protein transporter activity 2.138 13.09
isomerase activity 1.598 11.81
active transmembrane transporter activity 1.679 9.52
protein serine/threonine kinase activity 1.686 8.02
RNA binding 1.279 4.8
poly(A) RNA binding 2.035 3.34

Protein sequence

External link(s) Locus: YKL186C   Protein: S000001669
Sequence length 184
Comment MTR2 SGDID:S000001669, Chr XI from 93303-92749, reverse complement, Verified ORF, "mRNA transport regulator, essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA"
Sequence
MNTNSNTMVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFA
QATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPI
QPNNTGNRNRPNDMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDS
LLKI
Download sequence
Identical sequences A6ZZD9 B3LQR9 C7GJ23 C8ZBZ0 E7KEP6 E7KQU8 E7LWN1 E7QH34 G2WHK6 H0GJJ6 N1NZM2 P34232 W7PGD5 W7QW84
1of5.B YKL186C YKL186C YKL186C YKL186C YKL186C 4932.YKL186C YKL186C YKL186C SCRT_03843 YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C 1of5B YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C tr|A6ZZD9|A6ZZD9_YEAS7 YT82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]