SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL186C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL186C
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily NTF2-like 4.82e-65
Family NTF2-like 1.91e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
protein serine/threonine kinase activity 1.73 15.75
GTPase binding 1.682 14.85
isomerase activity 1.669 12.5
P-P-bond-hydrolysis-driven transmembrane transporter activity 1.99 11.73
protein transporter activity 2.239 11.73
mRNA binding 2.042 5.3
RNA binding 1.361 5.22
Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 40.58
axon 1.502 23.58
microtubule cytoskeleton 1.333 20
sarcoplasmic reticulum 1.985 14.66
nuclear envelope 1.697 13.95
cell-cell junction 1.375 13.83
intercalated disc 1.961 13.83
main axon 2.059 13.07
organelle inner membrane 1.672 11.88
mitochondrial envelope 1.57 11.88

Protein sequence

External link(s) Locus: YKL186C   Protein: S000001669
Sequence length 184
Comment MTR2 SGDID:S000001669, Chr XI from 93303-92749, reverse complement, Verified ORF, "mRNA transport regulator, essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA"
Sequence
MNTNSNTMVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFA
QATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPI
QPNNTGNRNRPNDMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDS
LLKI
Download sequence
Identical sequences A6ZZD9 B3LQR9 C7GJ23 C8ZBZ0 E7KEP6 E7KQU8 E7LWN1 E7QH34 G2WHK6 H0GJJ6 N1NZM2 P34232 W7PGD5 W7QW84
YKL186C 1of5B YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C YT82 YKL186C YKL186C YKL186C YKL186C 4932.YKL186C YKL186C YKL186C SCRT_03843 YKL186C YKL186C tr|A6ZZD9|A6ZZD9_YEAS7 YKL186C 1of5.B YKL186C YKL186C YKL186C YKL186C YKL186C YKL186C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]