SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL216W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL216W
Domain Number 1 Region: 3-311
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.41e-71
Family FMN-linked oxidoreductases 1.49e-09
Further Details:      
 

Most Informative Gene Ontologies

Protein sequence

External link(s) Locus: YKL216W   Protein: S000001699
Sequence length 314
Comment URA1 SGDID:S000001699, Chr XI from 25216-26160, Verified ORF, "Dihydroorotate dehydrogenase, catalyzes the fourth enzymatic step in the de novo biosynthesis of pyrimidines, converting dihydroorotic acid into orotic acid"
Sequence
MTASLTTKFLNNTYENPFMNASGVHCMTTQELDELANSKAGAFITKSATTLEREGNPEPR
YISVPLGSINSMGLPNEGIDYYLSYVLNRQKNYPDAPAIFFSVAGMSIDENLNLLRKIQD
SEFNGITELNLSCPNVPGKPQVAYDFDLTKETLEKVFAFFKKPLGVKLPPYFDFAHFDIM
AKILNEFPLAYVNSINSIGNGLFIDVEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYT
RLRPEIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAKG
YTSIDQFRGKLNSI
Download sequence
Identical sequences G2WHH8 N1NZQ4 P28272
YKL216W YKL216W 4932.YKL216W YKL216W YKL216W YKL216W YKL216W YKL216W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]