SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YKL225W   Protein: S000001708
Sequence length 115
Comment YKL225W SGDID:S000001708, Chr XI from 452-799, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLRIYHSQLTLLSHSTPWPSLTKSVRCTHIIIHGTCLSGLYPVQFTHKTHDYPHFNIYIS
FSGSKYCITALNAYIIPLLLHILTIQFIHTYFNIPTKSPLKLPKHKNILLFNNNT
Download sequence
Identical sequences P36030
YKL225W 4932.YKL225W YKL225W YKL225W

Jump to [ Top of page · Domain architecture · Domain assignment details ]