SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL225W   Protein: S000001708
Sequence length 115
Comment YKL225W SGDID:S000001708, Chr XI from 452-799, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLRIYHSQLTLLSHSTPWPSLTKSVRCTHIIIHGTCLSGLYPVQFTHKTHDYPHFNIYIS
FSGSKYCITALNAYIIPLLLHILTIQFIHTYFNIPTKSPLKLPKHKNILLFNNNT
Download sequence
Identical sequences P36030
YKL225W YKL225W 4932.YKL225W YKL225W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]