SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR026C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR026C
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.86e-83
Family IF2B-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.418 5.2
spliceosomal complex 2.025 5.2

Protein sequence

External link(s) Locus: YKR026C   Protein: S000001734
Sequence length 305
Comment GCN3 SGDID:S000001734, Chr XI from 489298-488381, reverse complement, Verified ORF, "Alpha subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a positive regulator of GCN4 expression"
Sequence
MSEFNITETYLRFLEEDTEMTMPIAAIEALVTLLRIKTPETAAEMINTIKSSTEELIKSI
PNSVSLRAGCDIFMRFVLRNLHLYGDWENCKQHLIENGQLFVSRAKKSRNKIAEIGVDFI
ADDDIILVHGYSRAVFSLLNHAANKFIRFRCVVTESRPSKQGNQLYTLLEQKGIPVTLIV
DSAVGAVIDKVDKVFVGAEGVAESGGIINLVGTYSVGVLAHNARKPFYVVTESHKFVRMF
PLSSDDLPMAGPPLDFTRRTDDLEDALRGPTIDYTAQEYITALITDLGVLTPSAVSEELI
KMWYD
Download sequence
Identical sequences A6ZZZ0 B3LRB0 B5VMH4 C7GNN3 C8ZCJ0 E7NK54 E7QHF6 G2WI57 N1P2N5 P14741 W7PDX6
YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C YKR026C 4932.YKR026C YKR026C SCRT_04046 YKR026C YKR026C YKR026C tr|A6ZZZ0|A6ZZZ0_YEAS7 YKR026C YKR026C YKR026c___KOG1466 YKR026C YKR026C YKR026C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]