SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR029C
Domain Number 1 Region: 319-462
Classification Level Classification E-value
Superfamily SET domain 3.01e-17
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number 2 Region: 113-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.13e-14
Family PHD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
N-methyltransferase activity 2.159 142.33
transferase activity, transferring one-carbon groups 1.589 92.94
histone binding 1.837 58.23
phospholipid binding 1.522 32.45
transcription regulatory region DNA binding 1.451 26.14
RNA polymerase II regulatory region DNA binding 2.129 26.14
transcription regulatory region sequence-specific DNA binding 2.101 26.14
N-acyltransferase activity 2.148 21.5
acetyltransferase activity 1.989 19.17
transferase activity, transferring hexosyl groups 2.238 15.58
Cellular Component IC (bits) H-Score
SWI/SNF superfamily-type complex 2.178 40.52
nucleoplasm part 1.418 35.07
methyltransferase complex 2.219 31.43
receptor complex 1.511 22.61
growth cone 2.019 18.79
chromosomal part 1.477 17.47
endosome membrane 1.968 10.54
nuclear chromosome 1.724 7.84
endosome 1.325 7.74
transcription factor complex 1.882 7.03
Biological Process IC (bits) H-Score
protein alkylation 2.104 142.12
macromolecule methylation 1.855 105.46
chromatin organization 1.581 69.99
peptidyl-lysine modification 1.985 64.27
apoptotic process 1.321 34.78
negative regulation of hydrolase activity 1.619 34.78
regulation of peptidase activity 1.465 34.78
regulation of cysteine-type endopeptidase activity involved in apoptotic process 1.877 34.78
regulation of cell cycle process 1.539 30.44
regulation of DNA metabolic process 1.672 30.44

Protein sequence

External link(s) Locus: YKR029C   Protein: S000001737
Sequence length 751
Comment SET3 SGDID:S000001737, Chr XI from 499475-497220, reverse complement, Verified ORF, "Defining member of the SET3 histone deacetylase complex which is a meiosis-specific repressor of sporulation genes; necessary for efficient transcription by RNAPII; one of two yeast proteins that contains both SET and PHD domains"
Sequence
MSVPNSKEQSLLDDASTLLLFSKGKKRAEEASKIGSKTDTIEHDESHEREKKGAIEMAAA
ALATASTVSLPLKKATEQSAAEAATSTAAKEETENQPQKQPQWPVPDSYIVDPDAGIITC
ICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQER
INVKTVEPSSSNNSASNKNNGRDRASSTTISDVGDSFSTDQDNTNHRDKRRKRNPSNNSI
DSKNESASVNSSDGLTSMPKKKEHFLSAKDAYGAIYLPLKDNVFKSDLIEPFLNKHMDDN
WVIQYPHKTFKSVSIEVKPYADIAYSRTYPGFTKLGVYLKKDCIKGDFIQEILGELDFYK
NYLTDPRNHYRIWGTAKRRVIFHSHWPIYIDARLSGNSTRYLRRSCQPNVELVTIKLQDT
DNRNDKSSGRKSSRIKFVLRALRDISEDEELYIKWQWDSKHPILKLIKGMTIDSLDDLER
YGLINSVETILSNGECGCGNNSKDCYLLKVKRYAQSLYKSVKSRGKMNNRYKLNEILNQY
NCKKRREPPILHRLEEKAQNTIERAPILLNNFYRQKFLNRNNGPKIPQKNTIDSTNNPDD
IAKPFKFALFAQHSSNISVPKKNETSEKPLIITKSTDYDESHITNIEELPIPVLLPINKT
SRQTANDVEESQSKNEHKLSRTPSLSNFNKELSKEAQHSQAKTKEIMTEASVNSRRESTP
ESIMHLSDFSSSQLHSKKKLSFADYRKKLLK
Download sequence
Identical sequences N1P827 P36124 W7PHH4
YKR029C YKR029C 4932.YKR029C YKR029C YKR029C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]