SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR029C
Domain Number 1 Region: 319-462
Classification Level Classification E-value
Superfamily SET domain 3.01e-17
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number 2 Region: 113-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000113
Family PHD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ATPase complex 2.002 33.88
methyltransferase complex 2.143 31.54
receptor complex 1.469 22.21
site of polarized growth 1.648 20.4
cytoplasmic region 1.567 14.28
endoplasmic reticulum subcompartment 1.59 10.76
chromosomal part 1.512 9.09
endosome 1.351 8.61
synapse part 1.419 8.4
endosome membrane 1.934 8.33

Protein sequence

External link(s) Locus: YKR029C   Protein: S000001737
Sequence length 751
Comment SET3 SGDID:S000001737, Chr XI from 499475-497220, reverse complement, Verified ORF, "Defining member of the SET3 histone deacetylase complex which is a meiosis-specific repressor of sporulation genes; necessary for efficient transcription by RNAPII; one of two yeast proteins that contains both SET and PHD domains"
Sequence
MSVPNSKEQSLLDDASTLLLFSKGKKRAEEASKIGSKTDTIEHDESHEREKKGAIEMAAA
ALATASTVSLPLKKATEQSAAEAATSTAAKEETENQPQKQPQWPVPDSYIVDPDAGIITC
ICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQER
INVKTVEPSSSNNSASNKNNGRDRASSTTISDVGDSFSTDQDNTNHRDKRRKRNPSNNSI
DSKNESASVNSSDGLTSMPKKKEHFLSAKDAYGAIYLPLKDNVFKSDLIEPFLNKHMDDN
WVIQYPHKTFKSVSIEVKPYADIAYSRTYPGFTKLGVYLKKDCIKGDFIQEILGELDFYK
NYLTDPRNHYRIWGTAKRRVIFHSHWPIYIDARLSGNSTRYLRRSCQPNVELVTIKLQDT
DNRNDKSSGRKSSRIKFVLRALRDISEDEELYIKWQWDSKHPILKLIKGMTIDSLDDLER
YGLINSVETILSNGECGCGNNSKDCYLLKVKRYAQSLYKSVKSRGKMNNRYKLNEILNQY
NCKKRREPPILHRLEEKAQNTIERAPILLNNFYRQKFLNRNNGPKIPQKNTIDSTNNPDD
IAKPFKFALFAQHSSNISVPKKNETSEKPLIITKSTDYDESHITNIEELPIPVLLPINKT
SRQTANDVEESQSKNEHKLSRTPSLSNFNKELSKEAQHSQAKTKEIMTEASVNSRRESTP
ESIMHLSDFSSSQLHSKKKLSFADYRKKLLK
Download sequence
Identical sequences A0A0L8VLQ5 N1P827 P36124
YKR029C 4932.YKR029C YKR029C YKR029C YKR029C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]