SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR029C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR029C
Domain Number 1 Region: 319-462
Classification Level Classification E-value
Superfamily SET domain 3.01e-17
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number 2 Region: 113-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.13e-14
Family PHD domain 0.005
Further Details:      
 

Protein sequence

External link(s) Locus: YKR029C   Protein: S000001737
Sequence length 751
Comment SET3 SGDID:S000001737, Chr XI from 499475-497220, reverse complement, Verified ORF, "Defining member of the SET3 histone deacetylase complex which is a meiosis-specific repressor of sporulation genes; necessary for efficient transcription by RNAPII; one of two yeast proteins that contains both SET and PHD domains"
Sequence
MSVPNSKEQSLLDDASTLLLFSKGKKRAEEASKIGSKTDTIEHDESHEREKKGAIEMAAA
ALATASTVSLPLKKATEQSAAEAATSTAAKEETENQPQKQPQWPVPDSYIVDPDAGIITC
ICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQER
INVKTVEPSSSNNSASNKNNGRDRASSTTISDVGDSFSTDQDNTNHRDKRRKRNPSNNSI
DSKNESASVNSSDGLTSMPKKKEHFLSAKDAYGAIYLPLKDNVFKSDLIEPFLNKHMDDN
WVIQYPHKTFKSVSIEVKPYADIAYSRTYPGFTKLGVYLKKDCIKGDFIQEILGELDFYK
NYLTDPRNHYRIWGTAKRRVIFHSHWPIYIDARLSGNSTRYLRRSCQPNVELVTIKLQDT
DNRNDKSSGRKSSRIKFVLRALRDISEDEELYIKWQWDSKHPILKLIKGMTIDSLDDLER
YGLINSVETILSNGECGCGNNSKDCYLLKVKRYAQSLYKSVKSRGKMNNRYKLNEILNQY
NCKKRREPPILHRLEEKAQNTIERAPILLNNFYRQKFLNRNNGPKIPQKNTIDSTNNPDD
IAKPFKFALFAQHSSNISVPKKNETSEKPLIITKSTDYDESHITNIEELPIPVLLPINKT
SRQTANDVEESQSKNEHKLSRTPSLSNFNKELSKEAQHSQAKTKEIMTEASVNSRRESTP
ESIMHLSDFSSSQLHSKKKLSFADYRKKLLK
Download sequence
Identical sequences P36124
YKR029C YKR029C 4932.YKR029C YKR029C YKR029C

Jump to [ Top of page · Domain architecture · Domain assignment details ]