SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR034W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR034W
Domain Number 1 Region: 27-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-17
Family Erythroid transcription factor GATA-1 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actomyosin 2.172 42.14
actin filament bundle 1.881 41.65
cell-substrate junction 1.548 36.55
actin cytoskeleton 1.374 22.88
integral component of plasma membrane 1.428 12.68
receptor complex 1.469 12.68
plasma membrane receptor complex 1.824 12.68
cell-cell junction 1.461 7.28
apical junction complex 1.901 7.28
intracellular ribonucleoprotein complex 1.368 6.5

Protein sequence

External link(s) Locus: YKR034W   Protein: S000001742
Sequence length 269
Comment DAL80 SGDID:S000001742, Chr XI from 506540-507349, Verified ORF, "Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Deh1p"
Sequence
MVLSDSLKLPSPTLSAAAGVDDCDGEDHPTCQNCFTVKTPLWRRDEHGTVLCNACGLFLK
LHGEPRPISLKTDTIKSRNRKKLNNNNVNTNANTHSNDPNKIFKRKKRLLTTGGGSLPTN
NPKVSILEKFMVSGSIKPLLKPKETVPNTKECSTQRGKFSLDPCEPSGKNYLYQINGSDI
YTSNIELTRLPNLSTLLEPSPFSDSAVPEIELTWKLHNEEEVIKLKTKISELELVTDLYK
KHIFQLNEKCKQLEVELHSRASVQSHPQH
Download sequence
Identical sequences A0A0L8VMK4 B3LRB5 B5VMI1 C8ZCJ8 E7KR64 E7LX02 E7QHF9 G2WI64 H0GJF3 N1P0H4 P26343
YKR034W YKR034W YKR034W SCRT_04052 YKR034W CX00006 YKR034W YKR034W YKR034W YKR034W YKR034W YKR034W 4932.YKR034W YKR034W YKR034W YKR034W YKR034W YKR034W YKR034W YKR034W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]