SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR055W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR055W
Domain Number 1 Region: 72-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-49
Family G proteins 0.00000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.39 26.96
microtubule associated complex 2.062 25.24
cilium 1.637 21.89
ciliary part 1.792 20.48
chromosomal part 1.471 20.12
transporter complex 1.657 19
midbody 2.148 18.28
side of membrane 1.57 16.03
endosome 1.318 12.91
nucleoplasm part 1.424 12.35

Protein sequence

External link(s) Locus: YKR055W   Protein: S000001763
Sequence length 291
Comment RHO4 SGDID:S000001763, Chr XI from 547858-548733, Verified ORF, "Non-essential small GTPase of the Rho/Rac subfamily of Ras-like proteins, likely to be involved in the establishment of cell polarity"
Sequence
MNTLLFKRKGGNCGNESNIVSQGSPSSSNLPESPGTLDEKNLPRLPTPFARSLSTIPSYE
QMKRTNKLPDYHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQI
IELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPI
MLVGLKSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLS
DSLYAPREPTHTIKNPFKRNTTRSDIDSSTGDTSVSISGTKRLRKNKCIIM
Download sequence
Identical sequences N1NZI1 Q00246
YKR055W YKR055W YKR055W YKR055W 4932.YKR055W YKR055W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]