SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR055W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR055W
Domain Number 1 Region: 72-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-49
Family G proteins 7.24e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YKR055W   Protein: S000001763
Sequence length 291
Comment RHO4 SGDID:S000001763, Chr XI from 547858-548733, Verified ORF, "Non-essential small GTPase of the Rho/Rac subfamily of Ras-like proteins, likely to be involved in the establishment of cell polarity"
Sequence
MNTLLFKRKGGNCGNESNIVSQGSPSSSNLPESPGTLDEKNLPRLPTPFARSLSTIPSYE
QMKRTNKLPDYHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQI
IELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPI
MLVGLKSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLS
DSLYAPREPTHTIKNPFKRNTTRSDIDSSTGDTSVSISGTKRLRKNKCIIM
Download sequence
Identical sequences Q00246
YKR055W YKR055W 4932.YKR055W YKR055W YKR055W YKR055W

Jump to [ Top of page · Domain architecture · Domain assignment details ]