SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR055W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR055W
Domain Number 1 Region: 72-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-49
Family G proteins 7.24e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribonucleoprotein complex 1.418 9.43
transcription factor complex 1.882 9.42

Protein sequence

External link(s) Locus: YKR055W   Protein: S000001763
Sequence length 291
Comment RHO4 SGDID:S000001763, Chr XI from 547858-548733, Verified ORF, "Non-essential small GTPase of the Rho/Rac subfamily of Ras-like proteins, likely to be involved in the establishment of cell polarity"
Sequence
MNTLLFKRKGGNCGNESNIVSQGSPSSSNLPESPGTLDEKNLPRLPTPFARSLSTIPSYE
QMKRTNKLPDYHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQI
IELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPI
MLVGLKSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLS
DSLYAPREPTHTIKNPFKRNTTRSDIDSSTGDTSVSISGTKRLRKNKCIIM
Download sequence
Identical sequences N1NZI1 Q00246
YKR055W YKR055W 4932.YKR055W YKR055W YKR055W YKR055W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]