SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR058W
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.35e-38
Family Glycogenin 7.9e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YKR058W   Protein: S000001766
Sequence length 616
Comment GLG1 SGDID:S000001766, Chr XI from 552412-554262, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin"
Sequence
MYKKLAIATLLYSADYLPGVFALGHQVNKLLEEAGKKGDIETCLIVTTSLFNGTLSELAK
NILQSIYTKIVLVEPLNCQEESIQKNSENLALLERPELSFALIKARLWELTQFEQVLYLD
SDTLPLNKEFLKLFDIMSKQTTSQVGAIADIGWPDMFNSGVMMLIPDADTASVLQNYIFE
NTSIDGSDQGILNQFFNQNCCTDELVKDSFSREWVQLSFTYNVTIPNLGYQSSPAMNYFK
PSIKLIHFIGKHKPWSLWSQKNFIKNEYHDQWNEVYEEFKEEHQLNNEVSKPKISDSDKT
ETPETITPVDAPPSNEPTTNQEIDTISTVEENVDNQNAEPVPNSDHSPAPNPVPLDFTKW
LTTFINKDHLTNQPVNESREYSKENDNNIINSSSNRDQESPPNSTQELNSSYSVVSTQAD
SDEHQNAEEEDSTTDNASNSGEESHLDDISTAASSNNNVSNQPDGKNFSNSKENNISVES
SPSNPEQKRSTDNIQKPSVSTNDLPDDVEPHTSVDDNIQYLEKDKEGYEEFLPDVYESNA
IDNEEEFFDDDARDATEGETKTSAVADKQEDMKLTAEETNQPQQEMPNFKFDWEDSDYLS
KVERCFPDDIFEYAVE
Download sequence
Identical sequences N1P2Q9 P36143
YKR058W 4932.YKR058W YKR058W YKR058W YKR058W YKR058W

Jump to [ Top of page · Domain architecture · Domain assignment details ]