SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR058W
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.35e-38
Family Glycogenin 7.9e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YKR058W   Protein: S000001766
Sequence length 616
Comment GLG1 SGDID:S000001766, Chr XI from 552412-554262, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin"
Sequence
MYKKLAIATLLYSADYLPGVFALGHQVNKLLEEAGKKGDIETCLIVTTSLFNGTLSELAK
NILQSIYTKIVLVEPLNCQEESIQKNSENLALLERPELSFALIKARLWELTQFEQVLYLD
SDTLPLNKEFLKLFDIMSKQTTSQVGAIADIGWPDMFNSGVMMLIPDADTASVLQNYIFE
NTSIDGSDQGILNQFFNQNCCTDELVKDSFSREWVQLSFTYNVTIPNLGYQSSPAMNYFK
PSIKLIHFIGKHKPWSLWSQKNFIKNEYHDQWNEVYEEFKEEHQLNNEVSKPKISDSDKT
ETPETITPVDAPPSNEPTTNQEIDTISTVEENVDNQNAEPVPNSDHSPAPNPVPLDFTKW
LTTFINKDHLTNQPVNESREYSKENDNNIINSSSNRDQESPPNSTQELNSSYSVVSTQAD
SDEHQNAEEEDSTTDNASNSGEESHLDDISTAASSNNNVSNQPDGKNFSNSKENNISVES
SPSNPEQKRSTDNIQKPSVSTNDLPDDVEPHTSVDDNIQYLEKDKEGYEEFLPDVYESNA
IDNEEEFFDDDARDATEGETKTSAVADKQEDMKLTAEETNQPQQEMPNFKFDWEDSDYLS
KVERCFPDDIFEYAVE
Download sequence
Identical sequences N1P2Q9 P36143
YKR058W 4932.YKR058W YKR058W YKR058W YKR058W YKR058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]