SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR059W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR059W
Domain Number 1 Region: 91-374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-73
Family Tandem AAA-ATPase domain 0.000000399
Further Details:      
 
Domain Number 2 Region: 58-100
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000611
Family Tandem AAA-ATPase domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.332 27.17
transporter complex 1.655 21.75
cilium 1.616 21.53
chromosomal part 1.456 20.39
ciliary part 1.785 20.28
midbody 2.192 17.88
side of membrane 1.587 15.98
protein-DNA complex 1.891 15.71
endosome 1.317 12.57
plasma membrane protein complex 1.484 10.85

Protein sequence

External link(s) Locus: YKR059W   Protein: S000001767
Sequence length 395
Comment TIF1 SGDID:S000001767, Chr XI from 554629-555816, Verified ORF, "Translation initiation factor eIF4A, identical to Tif2p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G"
Sequence
MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIK
VHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGF
KEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVN
VEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVA
INFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
Download sequence
Identical sequences A6ZQJ1 B3LRD4 C8ZCM2 E7KE57 E7KQ74 E7LW24 E7NK76 E7Q5E8 E7QGE4 G2WI87 H0GI72 N1P0I8 P10081 W7Q0Q6 W7RCW8
YJL138C YKR059W SCRT_04075 YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W 2vso.A 2vso.B 2vsx.A 2vsx.B YKR059W YKR059W YKR059w___KOG0327 sp|A6ZQJ1|IF4A_YEAS7 4932.YJL138C 4932.YKR059W YJL138C YKR059W YJL138C YKR059W YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YKR059W YJL138C YKR059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]