SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR060W
Domain Number 1 Region: 16-255
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.62e-21
Family Ribosomal protein L1 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YKR060W   Protein: S000001768
Sequence length 274
Comment UTP30 SGDID:S000001768, Chr XI from 556160-556984, Verified ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data"
Sequence
MVESNDIIKSGLAEKALKALILQCEENPSLKNDKDIHIIINTGKKMGINRDNIPRIIPLT
KYKLFKPRDLNILLITKDPSALYRETLTKDEHTSELFKEIISVKNLRRRFKGSKLTQLYK
DFDLVVADYRVHHLLPEVLGSRFYHGSKKLPYMIRMSKEVKLKRQQMVEKCDPIYVRAQL
RSICKNTSYIPNNDNCLSVRVGYIQKHSIPEILQNIQDTINFLTDKSKRPQGGVIKGGII
SIFVKTSNSTSLPIYQFSEARENQKNEDLSDIKL
Download sequence
Identical sequences P36144
YKR060W 4932.YKR060W YKR060W YT223 YKR060W YKR060W

Jump to [ Top of page · Domain architecture · Domain assignment details ]