SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR060W
Domain Number 1 Region: 16-255
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.62e-21
Family Ribosomal protein L1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 14.31
intracellular ribonucleoprotein complex 1.323 10.59
cytosolic part 1.678 10.18
cytosolic ribosome 2.062 9.4
nucleolus 1.715 5.74
mitochondrial matrix 1.568 4.3
mitochondrial ribosome 2.079 4.3
Biological Process IC (bits) H-Score
regulation of cellular response to stress 1.412 28.17
translation 1.516 10.23
ribosome biogenesis 1.945 6.05
mitochondrion organization 1.534 4.45
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.965 25.65

Protein sequence

External link(s) Locus: YKR060W   Protein: S000001768
Sequence length 274
Comment UTP30 SGDID:S000001768, Chr XI from 556160-556984, Verified ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data"
Sequence
MVESNDIIKSGLAEKALKALILQCEENPSLKNDKDIHIIINTGKKMGINRDNIPRIIPLT
KYKLFKPRDLNILLITKDPSALYRETLTKDEHTSELFKEIISVKNLRRRFKGSKLTQLYK
DFDLVVADYRVHHLLPEVLGSRFYHGSKKLPYMIRMSKEVKLKRQQMVEKCDPIYVRAQL
RSICKNTSYIPNNDNCLSVRVGYIQKHSIPEILQNIQDTINFLTDKSKRPQGGVIKGGII
SIFVKTSNSTSLPIYQFSEARENQKNEDLSDIKL
Download sequence
Identical sequences N1P847 P36144
YKR060W YKR060W YT223 4932.YKR060W YKR060W YKR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]