SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR066C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR066C
Domain Number 1 Region: 73-344
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.39e-83
Family CCP-like 1.32e-09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.635 14.53
cell-cell junction 1.376 6.25
vacuole 1.428 6.14
symplast 2.046 5.92
plastid 1.598 5.19
chloroplast part 1.897 5.19
cilium 1.611 4.71
nonmotile primary cilium 1.974 4.71
cell wall 1.752 4.63

Protein sequence

External link(s) Locus: YKR066C   Protein: S000001774
Sequence length 361
Comment CCP1 SGDID:S000001774, Chr XI from 566840-565755, reverse complement, Verified ORF, "Mitochondrial cytochrome-c peroxidase; degrades reactive oxygen species in mitochondria, involved in the response to oxidative stress"
Sequence
MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWG
KAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHT
SGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGV
TAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG
AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLP
TDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQG
L
Download sequence
Identical sequences P00431
YKR066C 4932.YKR066C YKR066C YKR066C YKR066C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]