SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR066C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR066C
Domain Number 1 Region: 73-344
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.39e-83
Family CCP-like 1.32e-09
Further Details:      
 

Protein sequence

External link(s) Locus: YKR066C   Protein: S000001774
Sequence length 361
Comment CCP1 SGDID:S000001774, Chr XI from 566840-565755, reverse complement, Verified ORF, "Mitochondrial cytochrome-c peroxidase; degrades reactive oxygen species in mitochondria, involved in the response to oxidative stress"
Sequence
MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWG
KAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHT
SGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGV
TAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG
AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLP
TDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQG
L
Download sequence
Identical sequences P00431
YKR066C 4932.YKR066C YKR066C YKR066C YKR066C

Jump to [ Top of page · Domain architecture · Domain assignment details ]