SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YKR069W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR069W
Domain Number 1 Region: 324-562
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.83e-58
Family Tetrapyrrole methylase 0.0000183
Further Details:      
 
Domain Number 2 Region: 153-206,252-278
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.00000000000000157
Family Siroheme synthase middle domains-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YKR069W   Protein: S000001777
Sequence length 593
Comment MET1 SGDID:S000001777, Chr XI from 571254-573035, Verified ORF, "S-adenosyl-L-methionine uroporphyrinogen III transmethylase, involved in the biosynthesis of siroheme, a prosthetic group used by sulfite reductase; required for sulfate assimilation and methionine biosynthesis"
Sequence
MVRDLVTLPSSLPLITAGFATDQVHLLIGTGSTDSVSVCKNRIHSILNAGGNPIVVNPSS
PSHTKQLQLEFGKFAKFEIVEREFRLSDLTTLGRVLVCKVVDRVFVDLPITQSRLCEEIF
WQCQKLRIPINTFHKPEFSTFNMIPTWVDPKGSGLQISVTTNGNGYILANRIKRDIISHL
PPNISEVVINMGYLKDRIINEDHKALLEEKYYQTDMSLPGFGYGLDEDGWESHKFNKLIR
EFEMTSREQRLKRTRWLSQIMEYYPMNKLSDIKLEDFETSSSPNKKTKQETVTEGVVPPT
DENIENGTKQLQLSEVKKEEGPKKLGKISLVGSGPGSVSMLTIGALQEIKSADIILADKL
VPQAILDLIPPKTETFIAKKFPGNAERAQQELLAKGLESLDNGLKVVRLKQGDPYIFGRG
GEEFNFFKDHGYIPVVLPGISSSLACTVLAQIPATQRDIADQVLICTGTGRKGALPIIPE
FVESRTTVFLMALHRANVLITGLLKHGWDGDVPAAIVERGSCPDQRVTRTLLKWVPEVVE
EIGSRPPGVLVVGKAVNALVEKDLINFDESRKFVIDEGFREFEVDVDSLFKLY
Download sequence
Identical sequences P36150
YKR069W YKR069W 4932.YKR069W YKR069W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]