SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR069W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR069W
Domain Number 1 Region: 324-562
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.83e-58
Family Tetrapyrrole methylase 1.83e-05
Further Details:      
 
Domain Number 2 Region: 153-206,252-278
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.57e-15
Family Siroheme synthase middle domains-like 0.0061
Further Details:      
 

Protein sequence

External link(s) Locus: YKR069W   Protein: S000001777
Sequence length 593
Comment MET1 SGDID:S000001777, Chr XI from 571254-573035, Verified ORF, "S-adenosyl-L-methionine uroporphyrinogen III transmethylase, involved in the biosynthesis of siroheme, a prosthetic group used by sulfite reductase; required for sulfate assimilation and methionine biosynthesis"
Sequence
MVRDLVTLPSSLPLITAGFATDQVHLLIGTGSTDSVSVCKNRIHSILNAGGNPIVVNPSS
PSHTKQLQLEFGKFAKFEIVEREFRLSDLTTLGRVLVCKVVDRVFVDLPITQSRLCEEIF
WQCQKLRIPINTFHKPEFSTFNMIPTWVDPKGSGLQISVTTNGNGYILANRIKRDIISHL
PPNISEVVINMGYLKDRIINEDHKALLEEKYYQTDMSLPGFGYGLDEDGWESHKFNKLIR
EFEMTSREQRLKRTRWLSQIMEYYPMNKLSDIKLEDFETSSSPNKKTKQETVTEGVVPPT
DENIENGTKQLQLSEVKKEEGPKKLGKISLVGSGPGSVSMLTIGALQEIKSADIILADKL
VPQAILDLIPPKTETFIAKKFPGNAERAQQELLAKGLESLDNGLKVVRLKQGDPYIFGRG
GEEFNFFKDHGYIPVVLPGISSSLACTVLAQIPATQRDIADQVLICTGTGRKGALPIIPE
FVESRTTVFLMALHRANVLITGLLKHGWDGDVPAAIVERGSCPDQRVTRTLLKWVPEVVE
EIGSRPPGVLVVGKAVNALVEKDLINFDESRKFVIDEGFREFEVDVDSLFKLY
Download sequence
Identical sequences P36150
YKR069W 4932.YKR069W YKR069W YKR069W

Jump to [ Top of page · Domain architecture · Domain assignment details ]