SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR075W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YKR075W-A   Protein: S000028669
Sequence length 89
Comment YKR075W-A SGDID:S000028669, Chr XI from 579854-580123, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; completely overlaps the uncharacterized gene YKR075W; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MSSNFTKALSLLSIEALISSTSSVTQHSVFFFKADFRFFVCFWSIWFWTGDISFSLLSML
VKSGPYNTVTSVSLFQLMDSGLDLEFCKP
Download sequence
Identical sequences Q8TGM9
YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A 4932.YKR075W-A YKR075W-A YKR075W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]