SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR075W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YKR075W-A   Protein: S000028669
Sequence length 89
Comment YKR075W-A SGDID:S000028669, Chr XI from 579854-580123, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; completely overlaps the uncharacterized gene YKR075W; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MSSNFTKALSLLSIEALISSTSSVTQHSVFFFKADFRFFVCFWSIWFWTGDISFSLLSML
VKSGPYNTVTSVSLFQLMDSGLDLEFCKP
Download sequence
Identical sequences Q8TGM9
YKR075W-A 4932.YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A YKR075W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]