SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR084C
Domain Number 1 Region: 167-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-58
Family G proteins 3.71e-06
Further Details:      
 
Domain Number 2 Region: 504-609
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.15e-15
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 396-496
Classification Level Classification E-value
Superfamily Translation proteins 4.8e-10
Family Elongation factors 0.008
Further Details:      
 

Protein sequence

External link(s) Locus: YKR084C   Protein: S000001792
Sequence length 611
Comment HBS1 SGDID:S000001792, Chr XI from 598532-596697, reverse complement, Verified ORF, "GTP binding protein with sequence similarity to the elongation factor class of G proteins, EF-1alpha and Sup35p; associates with Dom34p, and shares a similar genetic relationship with genes that encode ribosomal protein components"
Sequence
MAYSDYSDGADDMPDFHDEGEFDDYLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLAL
FDNNFDLESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLD
EEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGK
STLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHF
STHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLA
SSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVY
KIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLAL
VSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRK
AYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKR
LISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRT
IAAGKISEITQ
Download sequence
Identical sequences A7A043 P32769
YKR084C YKR084C 4932.YKR084C YKR084C YKR084C YKR084C tr|A7A043|A7A043_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]