SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR084C
Domain Number 1 Region: 167-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-58
Family G proteins 3.71e-06
Further Details:      
 
Domain Number 2 Region: 504-609
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.15e-15
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 396-496
Classification Level Classification E-value
Superfamily Translation proteins 4.8e-10
Family Elongation factors 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
external encapsulating structure 1.635 17.38
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribosomal subunit 2.011 11.59

Protein sequence

External link(s) Locus: YKR084C   Protein: S000001792
Sequence length 611
Comment HBS1 SGDID:S000001792, Chr XI from 598532-596697, reverse complement, Verified ORF, "GTP binding protein with sequence similarity to the elongation factor class of G proteins, EF-1alpha and Sup35p; associates with Dom34p, and shares a similar genetic relationship with genes that encode ribosomal protein components"
Sequence
MAYSDYSDGADDMPDFHDEGEFDDYLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLAL
FDNNFDLESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLD
EEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGK
STLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHF
STHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLA
SSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVY
KIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLAL
VSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRK
AYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKR
LISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRT
IAAGKISEITQ
Download sequence
Identical sequences A7A043 P32769
YKR084C YKR084C 4932.YKR084C YKR084C YKR084C YKR084C tr|A7A043|A7A043_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]