SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR084C
Domain Number 1 Region: 167-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-58
Family G proteins 0.00000371
Further Details:      
 
Domain Number 2 Region: 504-609
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000000000000115
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 396-496
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000048
Family Elongation factors 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Locus: YKR084C   Protein: S000001792
Sequence length 611
Comment HBS1 SGDID:S000001792, Chr XI from 598532-596697, reverse complement, Verified ORF, "GTP binding protein with sequence similarity to the elongation factor class of G proteins, EF-1alpha and Sup35p; associates with Dom34p, and shares a similar genetic relationship with genes that encode ribosomal protein components"
Sequence
MAYSDYSDGADDMPDFHDEGEFDDYLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLAL
FDNNFDLESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLD
EEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGK
STLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHF
STHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLA
SSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVY
KIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLAL
VSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRK
AYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKR
LISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRT
IAAGKISEITQ
Download sequence
Identical sequences A7A043 P32769
YKR084C tr|A7A043|A7A043_YEAS7 YKR084C 4932.YKR084C YKR084C YKR084C 5m1j.A6 YKR084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]