SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR093W
Domain Number 1 Region: 67-299,335-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-18
Family Glycerol-3-phosphate transporter 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
clathrin-coated vesicle 1.877 13.61
cell projection membrane 1.528 11.05
secretory granule 1.827 9.35
vacuole 1.428 8.86
brush border 1.481 8.21
coated vesicle 1.745 8.06
cytoplasmic vesicle membrane 1.923 7.95
transport vesicle 2.075 7.66
synapse part 1.513 6.53
sperm part 2.208 6.33

Protein sequence

External link(s) Locus: YKR093W   Protein: S000001801
Sequence length 601
Comment PTR2 SGDID:S000001801, Chr XI from 615372-617177, Verified ORF, "Integral membrane peptide transporter, mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p"
Sequence
MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF
EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS
LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL
QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI
YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP
ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE
IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK
Y
Download sequence
Identical sequences P32901
YKR093W YKR093W 4932.YKR093W YKR093W 2177S YKR093W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]