SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR093W
Domain Number 1 Region: 67-299,335-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-18
Family Glycerol-3-phosphate transporter 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
carbohydrate transport 2.202 59.96
ion transport 1.478 33.86
nitrogen compound transport 1.741 33.7
transmembrane transport 1.614 30.18
secretion 1.518 28.86
renal system process 1.887 28.86
synaptic vesicle cycle 2.221 16.87
neurotransmitter transport 2.134 16.87
cellular chemical homeostasis 1.528 15.74
ion homeostasis 1.497 15.74
Cellular Component IC (bits) H-Score
vacuolar part 1.508 14.07
cytoplasmic vesicle part 1.438 13.31
vesicle membrane 1.7 13.31
cell projection membrane 1.792 10.75
clathrin-coated vesicle 2.036 10.25
secretory vesicle 1.533 10.12
presynapse 1.761 9.44
integral component of plasma membrane 1.37 7.83
exocytic vesicle 2.005 6.94
brush border 1.358 6.66

Protein sequence

External link(s) Locus: YKR093W   Protein: S000001801
Sequence length 601
Comment PTR2 SGDID:S000001801, Chr XI from 615372-617177, Verified ORF, "Integral membrane peptide transporter, mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p"
Sequence
MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF
EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS
LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL
QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI
YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP
ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE
IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK
Y
Download sequence
Identical sequences P32901
YKR093W YKR093W 4932.YKR093W YKR093W YKR093W 2177S

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]