SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR094C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR094C
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-34
Family Ubiquitin-related 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
adherens junction 1.365 21.75
axon 1.505 20.53
neuron projection terminus 2.132 20.53
endoplasmic reticulum part 1.431 17.73
cell leading edge 1.449 15.7
cytosol 1.301 13.01
cell cortex 1.627 9.88
filopodium 1.907 8.2
cell-substrate junction 1.6 7.97
dendrite 1.585 7.15

Protein sequence

External link(s) Locus: YKR094C   Protein: S000001802
Sequence length 128
Comment RPL40B SGDID:S000001802, Chr XI from 618392-618385,618016-617638, reverse complement, Verified ORF, "Fusion protein, identical to Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes"
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
Download sequence
Identical sequences A6ZVC8 B3LRG8 C8ZAW5 G2WG04 H2AYM5 N1P2T8 P0CH08 P0CH09 W7PPA1 W7QT73
YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C tr|A6ZVC8|A6ZVC8_YEAS7 YIL148W YKR094C YIL148W YKR094C YIL148W YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C 4932.YIL148W 4932.YKR094C YIL148W YKR094C YIL148W YKR094C SCRT_04110 SCRT_05321 YKR094C YIL148W YKR094C 1vw8.n 1vwu.n 1vxv.n 1vxy.n 3u5e.m 3u5i.m 4b6a.m 4byn.m 4byu.m 4cuw.m YIL148w___KOG0003 YIL148W YIL148W YKR094C YIL148W YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]