SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR101W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR101W
Domain Number 1 Region: 486-612
Classification Level Classification E-value
Superfamily ORC1-binding domain 1.26e-51
Family ORC1-binding domain 1.7e-07
Further Details:      
 
Domain Number 2 Region: 24-152
Classification Level Classification E-value
Superfamily ORC1-binding domain 2.75e-45
Family ORC1-binding domain 0.00064
Further Details:      
 
Weak hits

Sequence:  YKR101W
Domain Number - Region: 180-230
Classification Level Classification E-value
Superfamily ORC1-binding domain 0.0011
Family ORC1-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YKR101W   Protein: S000001809
Sequence length 678
Comment SIR1 SGDID:S000001809, Chr XI from 640106-642142, Verified ORF, "Protein involved in repression of transcription at the silent mating-type loci HML and HMR; recruitment to silent chromatin requires interactions with Orc1p and with Sir4p, through a common Sir1p domain; binds to centromeric chromatin"
Sequence
MRTIMSIITRRYKQLKNYKIISKKMLQINSRLAVIDGWLVDTVKRKPINFRSPEVRLLLP
NDDDYKKLSQQNLVDWTRLKKDSNSVLVGVKSMELFKHIKLVLREFFLLEDGRIILKRIR
SKLRYKVVKKLTCKCCRLYLPKWGTVYIHPMLKDKEKPLAGVCEFSLDVNPDREYPLIEI
NVSHQYIIIEGFLLYLNERRLYRWNDNNLRSQVGLTKWAHLRKTYNPVSLDILYSLNSNF
YFVKDDLLFQLLGKRVFVKFCKVMENGKCGKAPLWYRVKRTTTAKATHIAYAISNSTAPD
SFKSKNNDYRFIVREKPIVENTISNLDYSDIKKQQFTEAEVVKRKISADISQIENVHTQF
NSQKEKNNIRVNKVSSEVLDQISKFPVSRVTLLLMSAGQDKNYIELVEELARRLEKICIE
KTTQSLEEIRDTFQANPEMQASFDKEYYQSIEEYKITLELIKEDLLITLIKQMENMWAAE
KKFSTEEEYVSPRFLVADGFLIDLAEEKPINPKDPRLLTLLKDHQRAMIDQMNLVKWNDF
KKYQDPIPLKAKTLFKFCKQIKKKFLRGADFKLHTLPTEANLKYEPERMTVLCSCVPILL
DDQTVQYLYDDSIIPEFEATSSYATKQSKCGRKMSLQMEPDLLFQEAIRRMRHLTAYDVL
RRNYIAAFEELYMGNCND
Download sequence
Identical sequences YKR101W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]