SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKR101W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR101W
Domain Number 1 Region: 486-612
Classification Level Classification E-value
Superfamily ORC1-binding domain 1.26e-51
Family ORC1-binding domain 1.7e-07
Further Details:      
 
Domain Number 2 Region: 24-152
Classification Level Classification E-value
Superfamily ORC1-binding domain 2.75e-45
Family ORC1-binding domain 0.00064
Further Details:      
 
Weak hits

Sequence:  YKR101W
Domain Number - Region: 180-230
Classification Level Classification E-value
Superfamily ORC1-binding domain 0.0011
Family ORC1-binding domain 0.0067
Further Details:      
 

Protein sequence

External link(s) Locus: YKR101W   Protein: S000001809
Sequence length 678
Comment SIR1 SGDID:S000001809, Chr XI from 640106-642142, Verified ORF, "Protein involved in repression of transcription at the silent mating-type loci HML and HMR; recruitment to silent chromatin requires interactions with Orc1p and with Sir4p, through a common Sir1p domain; binds to centromeric chromatin"
Sequence
MRTIMSIITRRYKQLKNYKIISKKMLQINSRLAVIDGWLVDTVKRKPINFRSPEVRLLLP
NDDDYKKLSQQNLVDWTRLKKDSNSVLVGVKSMELFKHIKLVLREFFLLEDGRIILKRIR
SKLRYKVVKKLTCKCCRLYLPKWGTVYIHPMLKDKEKPLAGVCEFSLDVNPDREYPLIEI
NVSHQYIIIEGFLLYLNERRLYRWNDNNLRSQVGLTKWAHLRKTYNPVSLDILYSLNSNF
YFVKDDLLFQLLGKRVFVKFCKVMENGKCGKAPLWYRVKRTTTAKATHIAYAISNSTAPD
SFKSKNNDYRFIVREKPIVENTISNLDYSDIKKQQFTEAEVVKRKISADISQIENVHTQF
NSQKEKNNIRVNKVSSEVLDQISKFPVSRVTLLLMSAGQDKNYIELVEELARRLEKICIE
KTTQSLEEIRDTFQANPEMQASFDKEYYQSIEEYKITLELIKEDLLITLIKQMENMWAAE
KKFSTEEEYVSPRFLVADGFLIDLAEEKPINPKDPRLLTLLKDHQRAMIDQMNLVKWNDF
KKYQDPIPLKAKTLFKFCKQIKKKFLRGADFKLHTLPTEANLKYEPERMTVLCSCVPILL
DDQTVQYLYDDSIIPEFEATSSYATKQSKCGRKMSLQMEPDLLFQEAIRRMRHLTAYDVL
RRNYIAAFEELYMGNCND
Download sequence
Identical sequences YKR101W

Jump to [ Top of page · Domain architecture · Domain assignment details ]