SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL011W
Domain Number 1 Region: 13-376
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-58
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YLL011W   Protein: S000003934
Sequence length 489
Comment SOF1 SGDID:S000003934, Chr XII from 127522-128991, Verified ORF, "Essential protein required for biogenesis of 40S (small) ribosomal subunit; has similarity to the beta subunit of trimeric G-proteins and the splicing factor Prp4p"
Sequence
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
Download sequence
Identical sequences B3LTF6 B5VMT3 C7GPG8 E7KFL8 G2WII4 N1P202 P33750 W7PMP7 W7QVF2
YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W SCRT_04978 YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W 4932.YLL011W YLL011W YLL011W YLL011W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]