SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL011W
Domain Number 1 Region: 13-376
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-58
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2

Protein sequence

External link(s) Locus: YLL011W   Protein: S000003934
Sequence length 489
Comment SOF1 SGDID:S000003934, Chr XII from 127522-128991, Verified ORF, "Essential protein required for biogenesis of 40S (small) ribosomal subunit; has similarity to the beta subunit of trimeric G-proteins and the splicing factor Prp4p"
Sequence
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
Download sequence
Identical sequences B3LTF6 B5VMT3 C7GPG8 E7KFL8 G2WII4 N1P202 P33750 W7PMP7 W7QVF2
YLL011W YLL011W YLL011W YLL011W 4932.YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W SCRT_04978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]