SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL011W
Domain Number 1 Region: 13-376
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-58
Family WD40-repeat 0.0011
Further Details:      
 

Protein sequence

External link(s) Locus: YLL011W   Protein: S000003934
Sequence length 489
Comment SOF1 SGDID:S000003934, Chr XII from 127522-128991, Verified ORF, "Essential protein required for biogenesis of 40S (small) ribosomal subunit; has similarity to the beta subunit of trimeric G-proteins and the splicing factor Prp4p"
Sequence
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
Download sequence
Identical sequences B3LTF6 B5VMT3 C7GPG8 E7KFL8 G2WII4 P33750
YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W 4932.YLL011W YLL011W YLL011W SCRT_04978 YLL011W YLL011W YLL011W YLL011W

Jump to [ Top of page · Domain architecture · Domain assignment details ]