SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL011W
Domain Number 1 Region: 13-376
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-58
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YLL011W   Protein: S000003934
Sequence length 489
Comment SOF1 SGDID:S000003934, Chr XII from 127522-128991, Verified ORF, "Essential protein required for biogenesis of 40S (small) ribosomal subunit; has similarity to the beta subunit of trimeric G-proteins and the splicing factor Prp4p"
Sequence
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
Download sequence
Identical sequences B3LTF6 B5VMT3 C7GPG8 E7KFL8 G2WII4 N1P202 P33750 W7PMP7 W7QVF2
YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W YLL011W 4932.YLL011W YLL011W YLL011W SCRT_04978 YLL011W YLL011W YLL011W YLL011W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]