SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL019C
Domain Number 1 Region: 305-452,479-587,689-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.21e-66
Family Protein kinases, catalytic subunit 9.94e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YLL019C   Protein: S000003942
Sequence length 737
Comment KNS1 SGDID:S000003942, Chr XII from 107898-105685, reverse complement, Verified ORF, "Nonessential putative protein kinase of unknown cellular role; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues"
Sequence
MSQNIQIGTRKRSRANMNNSTTTGPANNTSSNKTFLDNFEETRTNKLLDEMFARQNSFLT
DNLRNSLDLNQADNPLRPRQHQHQLFLDNENAIELDEEPRIINTTINNSNNHNSSRVDED
ADDDIIFIKEQPIQFSSPLILPSSSSINNNNNIVTSNNPGCGTAATSNSTYITTPKKFKK
QRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVTQTENELLHLTGSCAKTLEGNKAVNL
TIAHSTSPFSNPPAQIASLPQSNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYV
YQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELR
ILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAI
ARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKI
LKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIG
ESLYPIHENLEHMAMMQRINGTPFPTDIIDKMFYKSKHKLGNSPSDLNSTVIKHFDRKTL
SLQWPEKNKRGDTITTEKSMKRVLQSCDRLDIYISKVLKQDYGDSLSINWNLPPEKNWSL
INSKLAWKRQTHSSSSSTTDELDKETFLFWYWFIDLLRKMFEFDPTKRITAKDALDHEWF
NLGILDDGIATYNNTQG
Download sequence
Identical sequences P32350
YLL019C YLL019C 4932.YLL019C YLL019C YLL019C

Jump to [ Top of page · Domain architecture · Domain assignment details ]