SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLL019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL019C
Domain Number 1 Region: 305-452,479-587,689-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.21e-66
Family Protein kinases, catalytic subunit 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plasma membrane receptor complex 1.824 13.31
spindle 1.815 12.85
cytosol 1.295 12.48
chromosomal part 1.512 9.33
synapse part 1.419 8.28
midbody 2.182 8.19
cell division site 2.125 8.13
nuclear chromosome part 1.842 8.05
site of polarized growth 1.648 7.71
cytoplasmic region 1.567 7.39
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.662 87.19
growth factor binding 1.592 45.46
ATP binding 1.433 38.77
lyase activity 1.408 25.05
cytokine binding 1.952 24.28
calmodulin binding 2.02 18.7
magnesium ion binding 1.87 15.88
double-stranded DNA binding 1.546 15.2
protein domain specific binding 1.452 12.79
enzyme activator activity 1.431 10.25

Protein sequence

External link(s) Locus: YLL019C   Protein: S000003942
Sequence length 737
Comment KNS1 SGDID:S000003942, Chr XII from 107898-105685, reverse complement, Verified ORF, "Nonessential putative protein kinase of unknown cellular role; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues"
Sequence
MSQNIQIGTRKRSRANMNNSTTTGPANNTSSNKTFLDNFEETRTNKLLDEMFARQNSFLT
DNLRNSLDLNQADNPLRPRQHQHQLFLDNENAIELDEEPRIINTTINNSNNHNSSRVDED
ADDDIIFIKEQPIQFSSPLILPSSSSINNNNNIVTSNNPGCGTAATSNSTYITTPKKFKK
QRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVTQTENELLHLTGSCAKTLEGNKAVNL
TIAHSTSPFSNPPAQIASLPQSNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYV
YQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELR
ILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAI
ARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKI
LKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIG
ESLYPIHENLEHMAMMQRINGTPFPTDIIDKMFYKSKHKLGNSPSDLNSTVIKHFDRKTL
SLQWPEKNKRGDTITTEKSMKRVLQSCDRLDIYISKVLKQDYGDSLSINWNLPPEKNWSL
INSKLAWKRQTHSSSSSTTDELDKETFLFWYWFIDLLRKMFEFDPTKRITAKDALDHEWF
NLGILDDGIATYNNTQG
Download sequence
Identical sequences P32350
YLL019C 4932.YLL019C YLL019C YLL019C YLL019C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]