SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL019C
Domain Number 1 Region: 305-452,479-587,689-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.21e-66
Family Protein kinases, catalytic subunit 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spindle 1.789 20.41
centrosome 1.793 14.51
cytosol 1.301 13.09
synapse part 1.451 11.52
axon 1.505 9.91
neuron projection terminus 2.132 9.91
chromosomal part 1.477 9.63
microtubule associated complex 1.998 9.07
transferase complex 1.423 8.89
nuclear chromosome 1.73 8.54

Protein sequence

External link(s) Locus: YLL019C   Protein: S000003942
Sequence length 737
Comment KNS1 SGDID:S000003942, Chr XII from 107898-105685, reverse complement, Verified ORF, "Nonessential putative protein kinase of unknown cellular role; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues"
Sequence
MSQNIQIGTRKRSRANMNNSTTTGPANNTSSNKTFLDNFEETRTNKLLDEMFARQNSFLT
DNLRNSLDLNQADNPLRPRQHQHQLFLDNENAIELDEEPRIINTTINNSNNHNSSRVDED
ADDDIIFIKEQPIQFSSPLILPSSSSINNNNNIVTSNNPGCGTAATSNSTYITTPKKFKK
QRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVTQTENELLHLTGSCAKTLEGNKAVNL
TIAHSTSPFSNPPAQIASLPQSNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYV
YQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELR
ILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAI
ARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKI
LKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIG
ESLYPIHENLEHMAMMQRINGTPFPTDIIDKMFYKSKHKLGNSPSDLNSTVIKHFDRKTL
SLQWPEKNKRGDTITTEKSMKRVLQSCDRLDIYISKVLKQDYGDSLSINWNLPPEKNWSL
INSKLAWKRQTHSSSSSTTDELDKETFLFWYWFIDLLRKMFEFDPTKRITAKDALDHEWF
NLGILDDGIATYNNTQG
Download sequence
Identical sequences P32350
YLL019C YLL019C 4932.YLL019C YLL019C YLL019C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]