SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL039C
Domain Number 1 Region: 151-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.6e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 2 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.63e-34
Family Ubiquitin-related 2.84e-05
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 4 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 5 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-33
Family Ubiquitin-related 2.57e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
adherens junction 1.365 21.78
synapse part 1.512 20.55
axon 1.502 20.55
neuron projection terminus 2.106 20.55
endoplasmic reticulum part 1.429 17.47
cell leading edge 1.447 15.73
cytosol 1.305 13.02
cell cortex 1.621 9.94
filopodium 1.891 8.56
cell-substrate junction 1.6 7.97

Protein sequence

External link(s) Locus: YLL039C   Protein: S000003962
Sequence length 381
Comment UBI4 SGDID:S000003962, Chr XII from 65206-64061, reverse complement, Verified ORF, "Ubiquitin, becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response; encoded as a polyubiquitin precursor comprised of 5 head-to-tail repeats"
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGN
Download sequence
Identical sequences A7A0L9 B3LTD4 C4YAP5 C8ZCT5 E7LX86 G2WIF8 P0CG63 W7PYP9
YLL039C 4932.YLL039C YLL039C YLL039C ORFP:15007 SCRT_04953 YLL039C tr|A7A0L9|A7A0L9_YEAS7 CLUT_05273 YLL039C YLL039C YLL039C YLL039C YR271 YLL039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]