SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL039C
Domain Number 1 Region: 151-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.6e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 2 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.63e-34
Family Ubiquitin-related 2.84e-05
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 4 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 2.57e-05
Further Details:      
 
Domain Number 5 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-33
Family Ubiquitin-related 2.57e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YLL039C   Protein: S000003962
Sequence length 381
Comment UBI4 SGDID:S000003962, Chr XII from 65206-64061, reverse complement, Verified ORF, "Ubiquitin, becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response; encoded as a polyubiquitin precursor comprised of 5 head-to-tail repeats"
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGN
Download sequence
Identical sequences A7A0L9 B3LTD4 C4YAP5 C8ZCT5 E7LX86 G2WIF8 P0CG63
YLL039C 4932.YLL039C YLL039C YLL039C ORFP:15007 SCRT_04953 YLL039C tr|A7A0L9|A7A0L9_YEAS7 CLUT_05273 YLL039C YLL039C YLL039C YLL039C YR271 YLL039C

Jump to [ Top of page · Domain architecture · Domain assignment details ]