SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL042C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLL042C   Protein: S000003965
Sequence length 167
Comment ATG10 SGDID:S000003965, Chr XII from 52589-52086, reverse complement, Verified ORF, "E2-like conjugating enzyme that mediates formation of the Atg12p-Atg5p conjugate, which is a critical step in autophagy"
Sequence
MIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLL
NHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTII
NLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS
Download sequence
Identical sequences B3LTD2 C7GRJ9 C8ZCT2 E7KFA7 E7LX84 E7NKC3 E7QI00 G2WIF5 H0GJU3 N1P173 Q07879 W7PMM4 W7R8B1
YLL042C YLL042C YLL042C YLL042C YLL042C YLL042C YLL042C GO.95020 YLL042C YLL042C 4932.YLL042C YLL042C YLL042C SCRT_04950 YLL042C YLL042C YLL042C YLL042C YLL042C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]