SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL065W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLL065W   Protein: S000003988
Sequence length 116
Comment YLL065W SGDID:S000003988, Chr XII from 11726-12076, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps chromosome XII telomeric element core sequences"
Sequence
MLQYIPLSNLPYSHIPLHHPSLTISTKCTRIIMHGTCLSGLYPVPFTHKVHHYPHFNIYI
SFGDPKYCITALNTYVIPLLHHILTTQFIHTYFNIPTKSPPKSPKHKNYLSFNFTK
Download sequence
Identical sequences Q99339
YLL065W YLL065W 4932.YLL065W YLL065W YLL065W YLL065W YLL065W

Jump to [ Top of page · Domain architecture · Domain assignment details ]