SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL065W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLL065W   Protein: S000003988
Sequence length 116
Comment YLL065W SGDID:S000003988, Chr XII from 11726-12076, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps chromosome XII telomeric element core sequences"
Sequence
MLQYIPLSNLPYSHIPLHHPSLTISTKCTRIIMHGTCLSGLYPVPFTHKVHHYPHFNIYI
SFGDPKYCITALNTYVIPLLHHILTTQFIHTYFNIPTKSPPKSPKHKNYLSFNFTK
Download sequence
Identical sequences Q99339
YLL065W YLL065W YLL065W YLL065W 4932.YLL065W YLL065W YLL065W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]