SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLL066W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLL066W-B   Protein: S000028672
Sequence length 56
Comment YLL066W-B SGDID:S000028672, Chr XII from 5605-5775, Uncharacterized ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIHHTHTPHPHHTHTHTHHTPTHSLTSTFTLAVTPYPAF
Download sequence
Identical sequences Q8TGJ7
YLL066W-B YLL066W-B 4932.YLL066W-B YLL066W-B YLL066W-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]