SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR025W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR025W   Protein: S000004015
Sequence length 240
Comment SNF7 SGDID:S000004015, Chr XII from 194453-195175, Verified ORF, "One of four subunits of the endosomal sorting complex required for transport III (ESCRT-III); involved in the sorting of transmembrane proteins into the multivesicular body (MVB) pathway; recruited from the cytoplasm to endosomal membranes"
Sequence
MWSSLFGWTSSNAKNKESPTKAIVRLREHINLLSKKQSHLRTQITNQENEARIFLTKGNK
VMAKNALKKKKTIEQLLSKVEGTMESMEQQLFSIESANLNLETMRAMQEGAKAMKTIHSG
LDIDKVDETMDEIREQVELGDEISDAISRPLITGANEVDEDELDEELDMLAQENANQETS
KIVNNNVNAAPISENKVSLPSVPSNKIKQSENSVKDGEEEEDEEDEDEKALRELQAEMGL
Download sequence
Identical sequences A7A0T1 B3LSZ8 C7GXH1 C8ZCZ7 E7KFC9 E7KRH0 E7LXC3 E7QHQ7 G2WIL9 H0GJZ9 N1P243 P39929 W7PZ03 W7QVG9
YLR025W YLR025W YLR025W YLR025W CX00030 4932.YLR025W tr|A7A0T1|A7A0T1_YEAS7 YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W YLR025W SCRT_05014 YLR025W YLR025W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]