SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR035C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR035C-A
Domain Number 1 Region: 62-212
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.31e-25
Family Retroviral integrase, catalytic domain 0.0086
Further Details:      
 
Domain Number 2 Region: 737-880,926-1061
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-09
Family Reverse transcriptase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.198 26.98
ribonucleoprotein granule 1.999 22.37
ribonucleoprotein complex 1.418 15.25
small nuclear ribonucleoprotein complex 2.005 13.11
exosome (RNase complex) 2.218 10.37
mitochondrial matrix 1.707 9.31
nuclear body 1.902 5.59
nucleoplasm part 1.418 5.59
chromosomal part 1.477 5.32
nuclear periphery 2.218 5.12

Protein sequence

External link(s) Locus: YLR035C-A   Protein: S000007225
Sequence length 1155
Comment YLR035C-A SGDID:S000007225, Chr XII from 218908-215441, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); YLR035C-A is part of a mutant retrotransposon"
Sequence
MLAHANAQTIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQN
SYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSILDVFTTILA
FIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLD
DCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPV
IVNDHNPNSKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFN
YDALTFDEDLNRLTASYQSFIASNEIQQSDDLNIESDHDFQSDIELHPEQPRNVLSKAVS
PTDSTPPSTHTEDSKRVSKTNIRAPREVDPNISESNILPSKKRSSTPQISDIESTGSGGM
HRLDVPLLAPMSQSNTHESSHASKSKDFRHSDSYSDNETNHTNVPISSTGGTNNKTVPQT
SEQETEKRIIHRSPSIDTSSSESNSLHHVVPIKTSDTCPKENTEESIIADLPLPDLPPEP
PTELSDSFKELPPINSHQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKN
MRSLEPPRSKKRIHLIAAVKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIQAYHKEVNQ
LLKMKTWDTDRYYDRKEIDPKRVINSMFIFNRKRGGTHKARFVARGDIQHPDTYDPGMQS
NTVHHYALMTSLSLASDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKS
LYGLKQSGANWYETIKSYLIKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANK
KIITTLKKQYDTKIINLGESDNEIQYDILGLEIKYQRGKYMKLGMENSLTEKIPKLNVPL
NPKGRKLSAPGQPGLYIDQQELELEEDDYKMKVHEMQKLIGLASYVGYKFRFDLLYYINT
LAQHILFPSKQVLDMTYELIQFIWNTRDKQLIWHKSKPVKPTNKLVVISDASYGNQPYYK
SQIGNIYLLNGKVIGGKSTKASLTCTSTTEAEIHAISESVPLLNNLSHLVQELNKKPITK
GLLTDSKSTISIIISNNEEKFRNRFFGTKAMRLRDEVSGNHLHVCYIETKKNIADVMTKP
LPIKTFKLLTNKWIH
Download sequence
Identical sequences YLR035C-A 4932.YLR035C-A YLR035C-A YR129 YLR035C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]