SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR048W
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Ribosomal protein S2 2.75e-63
Family Ribosomal protein S2 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.939 39.35
intracellular ribonucleoprotein complex 1.329 22.36
organellar ribosome 2.064 13.79
cytosolic part 1.704 9.42
mitochondrial matrix 1.568 8.12
cytosolic ribosome 2.192 4.03
Biological Process IC (bits) H-Score
translation 1.507 25.66
ribosome biogenesis 1.84 16.45
ribonucleoprotein complex biogenesis 1.694 14.09
ncRNA metabolic process 1.489 6.5
rRNA metabolic process 2.096 6.5
ribonucleoprotein complex assembly 1.923 5.54
RNA processing 1.496 4.58
ncRNA processing 1.829 4.58
Molecular Function IC (bits) H-Score
extracellular matrix binding 2.05 18.55
structural constituent of ribosome 1.946 4.25

Protein sequence

External link(s) Locus: YLR048W   Protein: S000004038
Sequence length 252
Comment RPS0B SGDID:S000004038, Chr XII from 242233-242322,242682-243350, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal"
Sequence
MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLA
ARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRL
VIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLARE
VLRLRGALVDRTQPWSIMPDLYFYRNPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEAT
EWAEENADNVEW
Download sequence
Identical sequences A7A0V3 B3LT19 C8ZD20 G2WIP1 N1NZ34 P46654 W7PCS1 W7QVJ5
YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W SCRT_05035 YLR048W 4932.YLR048W YLR048W YLR048W YLR048W sp|A7A0V3|RSSA2_YEAS7 YLR048W YLR048W YLR048W YLR048W YLR048W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]