SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR048W
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Ribosomal protein S2 2.75e-63
Family Ribosomal protein S2 2.06e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YLR048W   Protein: S000004038
Sequence length 252
Comment RPS0B SGDID:S000004038, Chr XII from 242233-242322,242682-243350, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal"
Sequence
MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLA
ARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRL
VIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLARE
VLRLRGALVDRTQPWSIMPDLYFYRNPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEAT
EWAEENADNVEW
Download sequence
Identical sequences A7A0V3 B3LT19 C8ZD20 G2WIP1 P46654
YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W YLR048W 4932.YLR048W YLR048W SCRT_05035 YLR048W YLR048W sp|A7A0V3|RSSA2_YEAS7 YLR048W YLR048W YLR048W YLR048W YLR048W

Jump to [ Top of page · Domain architecture · Domain assignment details ]