SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR055C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR055C
Domain Number 1 Region: 176-209,252-360,429-583
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-34
Family WD40-repeat 0.015
Further Details:      
 
Weak hits

Sequence:  YLR055C
Domain Number - Region: 93-204
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.00863
Family Thermostable phytase (3-phytase) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YLR055C   Protein: S000004045
Sequence length 602
Comment SPT8 SGDID:S000004045, Chr XII from 253081-251273, reverse complement, Verified ORF, "Subunit of the SAGA transcriptional regulatory complex but not present in SAGA-like complex SLIK/SALSA, required for SAGA-mediated inhibition at some promoters"
Sequence
MDEVDDILINNQVVDDEEDDEEMLSGLENDSKQDLEGNDDGGEDEEDDDDDDEDDDDDED
EREDDDEQEDDDGEDDAARMDKTATPTNEHQHDEQKAAAAGAGGAGDSGDAVTKIGSEDV
KLSDVDGGVGSREASSSTHEASANGEVYEYYKHMLNAAQIADSYNIYPTAAIPIQTHVNA
LAVSRGLKYLFLGGSDGYIRKYDLLNTLEGKLSLTILQKHSLAESIQNAGILQSYWENEI
PQKKSEMKLSANKTDYEPKVSPVHSLEVQSECLFILSGLQNGGITMQGVRYMEGSIAHYF
KGRNGHTQIVNILRLNGQEDRFLSGSWDKRLLEWDLQTGDIVNEFKKSRSELSSLEMRPL
YSSVDVSGNVNSGKENENADDDMDSLFGDEDEDEKQDAGNEPVETGDGSNGEENKEQISE
ESLNIVYDESVFMTSGLNGSVHIWDRRMTQSPALSLERGAGVPPWCLSACWGVDGDHVYA
GRRNACVEQFDLKMPSKPIHNLKLPSISGPVSCVKAMPNNKHLLCASRDNIRLYNVEIAV
DASNSTTKSSKVPFLIVPGHHGGIISNLYLDPTSRFIISTSGNRGWQGNSTDTTLIYDID
LE
Download sequence
Identical sequences P38915
YLR055C YLR055C 4932.YLR055C YLR055C YLR055C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]