SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR055C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR055C
Domain Number 1 Region: 176-209,252-360,429-583
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-34
Family WD40-repeat 0.015
Further Details:      
 
Weak hits

Sequence:  YLR055C
Domain Number - Region: 93-204
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.00863
Family Thermostable phytase (3-phytase) 0.03
Further Details:      
 

Protein sequence

External link(s) Locus: YLR055C   Protein: S000004045
Sequence length 602
Comment SPT8 SGDID:S000004045, Chr XII from 253081-251273, reverse complement, Verified ORF, "Subunit of the SAGA transcriptional regulatory complex but not present in SAGA-like complex SLIK/SALSA, required for SAGA-mediated inhibition at some promoters"
Sequence
MDEVDDILINNQVVDDEEDDEEMLSGLENDSKQDLEGNDDGGEDEEDDDDDDEDDDDDED
EREDDDEQEDDDGEDDAARMDKTATPTNEHQHDEQKAAAAGAGGAGDSGDAVTKIGSEDV
KLSDVDGGVGSREASSSTHEASANGEVYEYYKHMLNAAQIADSYNIYPTAAIPIQTHVNA
LAVSRGLKYLFLGGSDGYIRKYDLLNTLEGKLSLTILQKHSLAESIQNAGILQSYWENEI
PQKKSEMKLSANKTDYEPKVSPVHSLEVQSECLFILSGLQNGGITMQGVRYMEGSIAHYF
KGRNGHTQIVNILRLNGQEDRFLSGSWDKRLLEWDLQTGDIVNEFKKSRSELSSLEMRPL
YSSVDVSGNVNSGKENENADDDMDSLFGDEDEDEKQDAGNEPVETGDGSNGEENKEQISE
ESLNIVYDESVFMTSGLNGSVHIWDRRMTQSPALSLERGAGVPPWCLSACWGVDGDHVYA
GRRNACVEQFDLKMPSKPIHNLKLPSISGPVSCVKAMPNNKHLLCASRDNIRLYNVEIAV
DASNSTTKSSKVPFLIVPGHHGGIISNLYLDPTSRFIISTSGNRGWQGNSTDTTLIYDID
LE
Download sequence
Identical sequences P38915
YLR055C YLR055C 4932.YLR055C YLR055C YLR055C

Jump to [ Top of page · Domain architecture · Domain assignment details ]