SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR058C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR058C
Domain Number 1 Region: 12-467
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.63e-175
Family GABA-aminotransferase-like 0.000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.423 41.94
endoplasmic reticulum part 1.431 41.94
mitochondrial matrix 1.714 9.9
oxidoreductase complex 1.872 8.82
mitochondrial envelope 1.573 5.12
organelle inner membrane 1.669 4.89
microbody 1.95 4.39
plastid 1.6 3.84

Protein sequence

External link(s) Locus: YLR058C   Protein: S000004048
Sequence length 469
Comment SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, converts serine to glycine plus 5,10 methylenetetrahydrofolate; major isoform involved in generating precursors for purine, pyrimidine, amino acid, and lipid biosynthesis"
Sequence
MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPL
SNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPDKWGVNVQTLSGSPANLQVYQ
AIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKN
AILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYAD
IVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI
AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVD
GARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVQYINKAV
EFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
Download sequence
Identical sequences B3LT29 C8ZD30 E7KFF3 G2WIQ1 H0GK29 N1NY19 P37291 W7PPB9 W7QVK0
YLR058C YLR058C YLR058C YLR058C 4932.YLR058C YLR058C SCRT_05045 YLR058C YLR058C YLR058C YLR058C YLR058C YLR058C YLR058C YLR058C YLR058C YLR058c___KOG2467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]