SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR058C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR058C
Domain Number 1 Region: 12-467
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.63e-175
Family GABA-aminotransferase-like 1.91e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YLR058C   Protein: S000004048
Sequence length 469
Comment SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, converts serine to glycine plus 5,10 methylenetetrahydrofolate; major isoform involved in generating precursors for purine, pyrimidine, amino acid, and lipid biosynthesis"
Sequence
MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPL
SNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPDKWGVNVQTLSGSPANLQVYQ
AIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKN
AILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYAD
IVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI
AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVD
GARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVQYINKAV
EFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
Download sequence
Identical sequences B3LT29 C8ZD30 E7KFF3 G2WIQ1 H0GK29 P37291
YLR058C 4932.YLR058C YLR058C YLR058C SCRT_05045 YLR058C YLR058C YLR058C YLR058C YLR058C YLR058C YLR058c___KOG2467 YLR058C YLR058C YLR058C YLR058C YLR058C

Jump to [ Top of page · Domain architecture · Domain assignment details ]