SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR061W   Protein: S000004051
Sequence length 121
Comment RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein"
Sequence
MAPNTSRKQKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQVTPEEDEEEDE
E
Download sequence
Identical sequences A0A0L8VKI4 A7A0W7 B3LT32 C8ZD33 G2WIQ4 N1P103 P05749
YLR061W YLR061W YLR061W 4932.YLR061W YLR061W YLR061W SCRT_05048 YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W 3j6x.62 3j6y.62 3j77.72 3j78.72 3jct.U 4v6i.BW 4v7f.V 4v88.BU 4v88.DU 4v8t.U 4v91.U 5apn.U 5apo.U 5fl8.U 5gak.W 5h4p.U 5jcs.U 5juo.Z 5jup.Z 5jus.Z 5jut.Z 5juu.Z 5mc6.BL 5t62.h 5t6r.h YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W NP_013162.1 YLR061W YLR061W YLR061W YLR061W tr|A7A0W7|A7A0W7_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]