SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR061W   Protein: S000004051
Sequence length 121
Comment RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein"
Sequence
MAPNTSRKQKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQVTPEEDEEEDE
E
Download sequence
Identical sequences A7A0W7 B3LT32 C8ZD33 G2WIQ4 N1P103 P05749 W7PFK1 W7R8I2
YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W 4932.YLR061W YLR061W YLR061W SCRT_05048 YLR061W YLR061W tr|A7A0W7|A7A0W7_YEAS7 YLR061W 3izc.W 3izs.W 3u5e.U 3u5i.U 4b6a.U YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W YLR061W

Jump to [ Top of page · Domain architecture · Domain assignment details ]