SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR075W
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily Ribosomal protein L16p/L10e 1.96e-73
Family Ribosomal protein L10e 3.38e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YLR075W   Protein: S000004065
Sequence length 221
Comment RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family"
Sequence
MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHLVSNELEQL
SSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWG
KPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQKIILSKKWGFTNLDRPE
YLKKREAGEVKDDGAFVKFLSKKGSLENNIREFPEYFAAQA
Download sequence
Identical sequences A7A0Y0 B3LT44 C7GQQ0 C8ZD46 E7KFG5 E7KRL4 E7LXG0 E7NKD4 E7Q6J6 E7QHU5 G2WIR7 H0GK44 P41805
YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W YLR075W 4932.YLR075W YLR075W YLR075W SCRT_05061 YLR075W YLR075W tr|A7A0Y0|A7A0Y0_YEAS7 YLR075W 3izc.I 3izs.I 3o58.J 3o5h.J 3u5e.I 3u5i.I 4b6a.I YLR075W YLR075W YLR075w___KOG0857 YLR075W YLR075W YLR075W YLR075W YLR075W

Jump to [ Top of page · Domain architecture · Domain assignment details ]