SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR105C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR105C
Domain Number 1 Region: 258-336
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 2.09e-25
Family tRNA-intron endonuclease catalytic domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
ncRNA processing 1.821 15.39
ncRNA metabolic process 1.499 12.16
RNA processing 1.497 10.39
Molecular Function IC (bits) H-Score
endonuclease activity 1.995 156.47
nuclease activity 1.592 13.08
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR105C   Protein: S000004095
Sequence length 377
Comment SEN2 SGDID:S000004095, Chr XII from 348181-347048, reverse complement, Verified ORF, "Subunit of the tRNA splicing endonuclease, which is composed of Sen2p, Sen15p, Sen34p, and Sen54p; Sen2p contains the active site for tRNA 5' splice site cleavage and has similarity to Sen34p and to Archaeal tRNA splicing endonuclease"
Sequence
MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALNDKVHVDFIGDT
TLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEARLGLNDTPLHNRGGTKSNTET
EMTLEKVTQQRRLQRLEFKKERAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQ
TEDVGIVAQQQDISESNLRDEDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPA
CLAGKLFQFDAKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEF
CVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKSNNFTKLFNSF
QVGEVLYKRWVPGRNRD
Download sequence
Identical sequences A7A109 B3LT73 C7GQS8 C8ZD76 E7KRN4 G2WIU8 H0GK70 N1NZ86 P16658 W7PCV2 W7QVN9
tr|A7A109|A7A109_YEAS7 YLR105C YLR105C YLR105C YLR105C YLR105C YLR105C YLR105C YLR105C 4932.YLR105C YLR105C CX00052 YLR105C YLR105C YLR105C YLR105C SCRT_05090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]