SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR117C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR117C
Domain Number 1 Region: 55-545
Classification Level Classification E-value
Superfamily TPR-like 3.7e-60
Family HAT/Suf repeat 0.011
Further Details:      
 
Domain Number 2 Region: 526-644
Classification Level Classification E-value
Superfamily TPR-like 2.28e-05
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Protein sequence

External link(s) Locus: YLR117C   Protein: S000004107
Sequence length 687
Comment CLF1 SGDID:S000004107, Chr XII from 384535-382472, reverse complement, Verified ORF, "Essential splicesome assembly factor; contains multiple tetratricopeptide repeat (TPR) protein-binding motifs and interacts specifically with many spliceosome components, may serve as a scaffold during splicesome assembly"
Sequence
MDTLEPTAVDTHVSAEQILRDVYKKGQKARGSTNIDILDLEELREYQRRKRTEYEGYLKR
NRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARN
LMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQK
NWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSD
MEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPSNQLLKAGLLDFEKQFGDINSIEET
ISYKRKMEYETILSNNAYDYDTWWLYLDLISESFPKQIMQTFEKAIVDSRPKELSKNVQW
KRYIYLWMRYICYVELELENSLLEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIRHDDV
PKARKILGKAIGLCPKAKTFKGYIELEVKLKEFDRVRKIYEKFIEFQPSDLQIWSQYGEL
EENLGDWDRVRGIYTIALDENSDFLTKEAKIVLLQKYITFETESQEFEKARKLYRRYLEL
NQYSPQSWIEFAMYQTSTPTEQQLLDLAKLQSENVDEDIEFEITDENKLEARKVFEEAIV
FFKEKDDKQGRLSILEALKDYEETYGTELDQETVKKRFPKVIKKVRLQNGVEEEFVDYIF
PDDIDDDKPKPSKFLELAKKWKQEQAL
Download sequence
Identical sequences N1NY82 Q12309
YLR117C 4932.YLR117C YLR117C YLR117C YLR117c___KOG1915 355002 YR291 YLR117C

Jump to [ Top of page · Domain architecture · Domain assignment details ]