SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR117C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR117C
Domain Number 1 Region: 55-545
Classification Level Classification E-value
Superfamily TPR-like 3.7e-60
Family HAT/Suf repeat 0.011
Further Details:      
 
Domain Number 2 Region: 526-644
Classification Level Classification E-value
Superfamily TPR-like 0.0000228
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YLR117C   Protein: S000004107
Sequence length 687
Comment CLF1 SGDID:S000004107, Chr XII from 384535-382472, reverse complement, Verified ORF, "Essential splicesome assembly factor; contains multiple tetratricopeptide repeat (TPR) protein-binding motifs and interacts specifically with many spliceosome components, may serve as a scaffold during splicesome assembly"
Sequence
MDTLEPTAVDTHVSAEQILRDVYKKGQKARGSTNIDILDLEELREYQRRKRTEYEGYLKR
NRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARN
LMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQK
NWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSD
MEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPSNQLLKAGLLDFEKQFGDINSIEET
ISYKRKMEYETILSNNAYDYDTWWLYLDLISESFPKQIMQTFEKAIVDSRPKELSKNVQW
KRYIYLWMRYICYVELELENSLLEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIRHDDV
PKARKILGKAIGLCPKAKTFKGYIELEVKLKEFDRVRKIYEKFIEFQPSDLQIWSQYGEL
EENLGDWDRVRGIYTIALDENSDFLTKEAKIVLLQKYITFETESQEFEKARKLYRRYLEL
NQYSPQSWIEFAMYQTSTPTEQQLLDLAKLQSENVDEDIEFEITDENKLEARKVFEEAIV
FFKEKDDKQGRLSILEALKDYEETYGTELDQETVKKRFPKVIKKVRLQNGVEEEFVDYIF
PDDIDDDKPKPSKFLELAKKWKQEQAL
Download sequence
Identical sequences N1NY82 Q12309
YLR117C YLR117c___KOG1915 YLR117C 355002 YR291 YLR117C 4932.YLR117C YLR117C 5lj5.S 5lqw.R 5mps.S 5mq0.S

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]