SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR120W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR120W-A   Protein: S000028674
Sequence length 33
Comment YLR120W-A SGDID:S000028674, Chr XII from 388673-388774, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data; partially overlaps the verified ORF YLR121C"
Sequence
MLFLLKSRKEGKEKVSIYSVYCFFLRKENGKDE
Download sequence
Identical sequences Q8TGR1
YLR120W-A YLR120W-A 4932.YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]