SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YLR120W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR120W-A   Protein: S000028674
Sequence length 33
Comment YLR120W-A SGDID:S000028674, Chr XII from 388673-388774, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data; partially overlaps the verified ORF YLR121C"
Sequence
MLFLLKSRKEGKEKVSIYSVYCFFLRKENGKDE
Download sequence
Identical sequences Q8TGR1
YLR120W-A YLR120W-A YLR120W-A YLR120W-A 4932.YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A YLR120W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]