SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YLR129W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR129W
Domain Number 1 Region: 325-690
Classification Level Classification E-value
Superfamily Nucleoporin domain 2.3e-67
Family Nucleoporin domain 0.024
Further Details:      
 
Domain Number 2 Region: 39-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.76e-37
Family WD40-repeat 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YLR129W   Protein: S000004119
Sequence length 943
Comment DIP2 SGDID:S000004119, Chr XII from 399658-402489, Verified ORF, "Nucleolar protein, specifically associated with the U3 snoRNA, part of the large ribonucleoprotein complex known as the small subunit (SSU) processome, required for 18S rRNA biogenesis, part of the active pre-rRNA processing complex"
Sequence
MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV
SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST
SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG
KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE
KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN
TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK
THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD
LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS
PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD
AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK
LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM
QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF
NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI
Download sequence
Identical sequences B3LT90 C8ZD98 E7KFJ9 N1NY95 Q12220 W7PCW4 W7QVP7
YLR129W YLR129W SCRT_05109 YLR129W YLR129W YR287 YLR129W 4932.YLR129W YLR129W YLR129W YLR129W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]