SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YLR136C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR136C
Domain Number 1 Region: 169-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000563
Family CCCH zinc finger 0.00087
Further Details:      
 
Domain Number 2 Region: 206-235
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000804
Family CCCH zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
RNA binding 1.36 8.2
chromatin binding 1.699 4.49
nucleic acid binding transcription factor activity 1.655 4.04
mRNA binding 2.041 3.71
phosphatase binding 2.004 3.57
Cellular Component IC (bits) H-Score
nucleoplasm part 1.418 33.42
ribonucleoprotein granule 1.999 10.15
ribonucleoprotein complex 1.418 9.5
spliceosomal complex 2.025 5.8
chromosomal part 1.477 4.49
chromatin 1.902 4.49

Protein sequence

External link(s) Locus: YLR136C   Protein: S000004126
Sequence length 285
Comment TIS11 SGDID:S000004126, Chr XII from 416659-415802, reverse complement, Verified ORF, "mRNA-binding protein expressed during iron starvation; binds to a sequence element in the 3'-untranslated regions of specific mRNAs to mediate their degradation; involved in iron homeostasis"
Sequence
MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETS
SEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVP
KSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTL
KGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAV
YVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW
Download sequence
Identical sequences A7A135 B3LT97 C7GMI8 C8ZDA5 E7KFK4 E7KRQ1 G2WIX5 H0GK93 N1NZQ0 P47977 W7PFR4 W7QZ53
YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C tr|A7A135|A7A135_YEAS7 YLR136C YLR136C YLR136C YLR136C SCRT_05116 4932.YLR136C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]