SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR136C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR136C
Domain Number 1 Region: 169-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 5.63e-10
Family CCCH zinc finger 0.00087
Further Details:      
 
Domain Number 2 Region: 206-235
Classification Level Classification E-value
Superfamily CCCH zinc finger 8.04e-07
Family CCCH zinc finger 0.0028
Further Details:      
 

Protein sequence

External link(s) Locus: YLR136C   Protein: S000004126
Sequence length 285
Comment TIS11 SGDID:S000004126, Chr XII from 416659-415802, reverse complement, Verified ORF, "mRNA-binding protein expressed during iron starvation; binds to a sequence element in the 3'-untranslated regions of specific mRNAs to mediate their degradation; involved in iron homeostasis"
Sequence
MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETS
SEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVP
KSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTL
KGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAV
YVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW
Download sequence
Identical sequences A7A135 B3LT97 C7GMI8 C8ZDA5 E7KFK4 E7KRQ1 G2WIX5 H0GK93 N1NZQ0 P47977 W7PFR4 W7QZ53
YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C YLR136C 4932.YLR136C YLR136C YLR136C SCRT_05116 YLR136C YLR136C tr|A7A135|A7A135_YEAS7 YLR136C YLR136C YLR136C

Jump to [ Top of page · Domain architecture · Domain assignment details ]