SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR145W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR145W   Protein: S000004135
Sequence length 201
Comment RMP1 SGDID:S000004135, Chr XII from 432169-432774, Verified ORF, "Subunit of RNase MRP, which processes pre-rRNA and has a role in cell cycle-regulated degradation of daughter cell-specific mRNAs; unlike most subunits, not shared between RNase MRP and nuclear RNase P"
Sequence
MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAK
RLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLW
EINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTE
NCKKKKKRKKKNKSAIDGIFG
Download sequence
Identical sequences B3LTA5 E7KFL0 E7Q6V5 G2WIY3 H0GKA0 N1P6N8 Q12530
YLR145W SCRT_05124 YLR145W YLR145W YLR145W YLR145W YLR145W YLR145W YLR145W 4932.YLR145W YLR145W YLR145W YLR145W YLR145W YLR145W YLR145W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]