SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR154W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR154W-B   Protein: S000028563
Sequence length 54
Comment YLR154W-B SGDID:S000028563, Chr XII from 454393-454557, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; encoded within the the 25S rRNA gene on the opposite strand"
Sequence
MLLLKSIRRHQDRSIVHLLRGPNLRSLSLRVWVLHPNTRIDVRLLGPCFKTGGI
Download sequence
Identical sequences C8ZDC8 H3G6J7 P0C5P9
164328.JGI46437 4932.YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B jgi|Phyra1_1|46437|gwEuk.2862.7.1 YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]