SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR154W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR154W-B   Protein: S000028563
Sequence length 54
Comment YLR154W-B SGDID:S000028563, Chr XII from 454393-454557, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; encoded within the the 25S rRNA gene on the opposite strand"
Sequence
MLLLKSIRRHQDRSIVHLLRGPNLRSLSLRVWVLHPNTRIDVRLLGPCFKTGGI
Download sequence
Identical sequences C8ZDC8 H3G6J7 P0C5P9
YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B jgi|Phyra1_1|46437|gwEuk.2862.7.1 YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B 164328.JGI46437 4932.YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B YLR154W-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]