SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR155C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR155C
Domain Number 1 Region: 33-356
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 8.77e-88
Family Glutaminase/Asparaginase 0.000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR155C   Protein: S000004145
Sequence length 362
Comment ASP3-1 SGDID:S000004145, Chr XII from 470406-469318, reverse complement, Verified ORF, "Cell-wall L-asparaginase II, involved in asparagine catabolism; expression is induced during nitrogen starvation; four copies of ASP3 are present in the genome reference strain S288C"
Sequence
MRSLNTLLLSLFVAMSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVG
LTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTH
GTDTMEETAFFLDLTINSEKPVCIAGAMRPATATSADGPMNLYQAVSIAASEKSLGRGTM
ITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNL
TDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY
GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFSGVY
GG
Download sequence
Identical sequences I9KWS0 P0CX77 P0CX78 P0CX79 P0CZ17
YLR155C YLR157C YLR158C YLR160C YLR155C YLR157C YLR158C YLR160C YLR155C YLR157C YLR158C YLR160C 4932.YLR155C 4932.YLR157C 4932.YLR158C 4932.YLR160C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]