SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR157C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR157C-A
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0654
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR157C-A   Protein: S000007373
Sequence length 440
Comment YLR157C-A SGDID:S000007373, Chr XII from 481602-480280, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPGTY
Download sequence
Identical sequences D2XNA6 P0CX70 P0CX71 P0CX72 P0CX73
4932.YDR365W-A 4932.YER137C-A 4932.YLR157C-A 4932.YPL257W-A YDR365W-A YER137C-A YLR157C-A YPL257W-A YDR365W-A YER137C-A YLR157C-A YPL257W-A YDR365W-A YER137C-A YLR157C-A YPL257W-A YAR010C YDR098C-A YDR316W-A YGR038C-A YGR161C-C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]