SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR159C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR159C-A   Protein: S000028566
Sequence length 43
Comment YLR159C-A SGDID:S000028566, Chr XII from 485843-485712, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-5"
Sequence
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW
Download sequence
Identical sequences P0CY02 P0CY03 P0CY04 P0CY05
YLR156C-A YLR157C-C YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A YLR156C-A YLR157C-C YLR159C-A 4932.YLR154C-H 4932.YLR156C-A 4932.YLR157C-C 4932.YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]