SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR159C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR159C-A   Protein: S000028566
Sequence length 43
Comment YLR159C-A SGDID:S000028566, Chr XII from 485843-485712, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-5"
Sequence
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW
Download sequence
Identical sequences P0CY02 P0CY03 P0CY04 P0CY05
YLR156C-A YLR157C-C YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A 4932.YLR154C-H 4932.YLR156C-A 4932.YLR157C-C 4932.YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A YLR156C-A YLR157C-C YLR159C-A YLR154C-H YLR156C-A YLR157C-C YLR159C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]