SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR159W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR159W   Protein: S000004149
Sequence length 114
Comment YLR159W SGDID:S000004149, Chr XII from 485346-485690, Uncharacterized ORF, "Putative protein of unknown function; YLR156W, YLR159W, and YLR161W are three identical open reading frames encoded near the ribosomal DNA region of chromosome 12"
Sequence
MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCM
RPANQEIYPLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT
Download sequence
Identical sequences I8R213 P0CE96 P0CE97 P0CE98
YLR156W YLR159W YLR161W 4932.YLR156W 4932.YLR159W 4932.YLR161W YLR156W YLR159W YLR161W YLR156W YLR157W-D YLR159W YLR161W YLR156W YLR157W-D YLR159W YLR161W YLR156W YLR157W-D YLR159W YLR161W YLR156W YLR159W YLR161W YLR156w

Jump to [ Top of page · Domain architecture · Domain assignment details ]