SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR162W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR162W-A   Protein: S000028567
Sequence length 62
Comment YLR162W-A SGDID:S000028567, Chr XII from 490407-490595, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR"
Sequence
MVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPGEIYCFYINCIMN
RR
Download sequence
Identical sequences Q3E811
YLR162W-A YLR162W-A 4932.YLR162W-A YLR162W-A YLR162W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]