SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR162W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR162W-A   Protein: S000028567
Sequence length 62
Comment YLR162W-A SGDID:S000028567, Chr XII from 490407-490595, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR"
Sequence
MVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPGEIYCFYINCIMN
RR
Download sequence
Identical sequences Q3E811
YLR162W-A YLR162W-A 4932.YLR162W-A YLR162W-A YLR162W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]