SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR186W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR186W
Domain Number 1 Region: 29-251
Classification Level Classification E-value
Superfamily alpha/beta knot 1.16e-82
Family EMG1/NEP1-like 1.18e-09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
RNA modification 2.178 40.25
ribosome biogenesis 2.067 26.51
nitrogen compound transport 1.602 12.06
rRNA metabolic process 2.197 9.52
ncRNA metabolic process 1.572 7.22
amide transport 2.127 7.1
ncRNA processing 1.877 6.45
RNA processing 1.458 6.01

Protein sequence

External link(s) Locus: YLR186W   Protein: S000004176
Sequence length 252
Comment EMG1 SGDID:S000004176, Chr XII from 523634-524392, Verified ORF, "Member of the alpha/beta knot fold methyltransferase superfamily; required for maturation of 18S rRNA and for 40S ribosome production; interacts with RNA and with S-adenosylmethionine; associates with spindle/microtubules; forms homodimers"
Sequence
MVEDSRVRDALKGGDQKALPASLVPQAPPVLTSKDKITKRMIVVLAMASLETHKISSNGP
GGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGI
LIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLLKVIKNPITDHLPTKCRKVTL
SFDAPVIRVQDYIEKLDDDESICVFVGAMARGKDNFADEYVDEKVGLSNYPLSASVACSK
FCHGAEDAWNIL
Download sequence
Identical sequences A7A176 B3RH77 B5VNA4 C7GIX3 C8ZDF7 E7KG20 E7LXN5 E7Q6X8 G2WJ18 N1P6S0 Q06287 W7PPK6 W7RGX0
YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W 355476 YR105 YLR186W YLR186W YLR186W 4932.YLR186W YLR186W SCRT_04146 YLR186W YLR186W tr|A7A176|A7A176_YEAS7 YLR186W YLR186W YLR186W YLR186W YLR186W YLR186W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]