SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR195C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR195C
Domain Number 1 Region: 219-455
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.74e-95
Family N-myristoyl transferase, NMT 5.21e-10
Further Details:      
 
Domain Number 2 Region: 35-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.84e-82
Family N-myristoyl transferase, NMT 7.91e-09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.418 11.12
perinuclear region of cytoplasm 1.481 5.79
chromosomal part 1.477 5.02
nuclear chromosome 1.72 5.02
chromatin 1.902 5.02

Protein sequence

External link(s) Locus: YLR195C   Protein: S000004185
Sequence length 455
Comment NMT1 SGDID:S000004185, Chr XII from 543306-541939, reverse complement, Verified ORF, "N-myristoyl transferase, catalyzes the cotranslational, covalent attachment of myristic acid to the N-terminal glycine residue of several proteins involved in cellular growth and signal transduction"
Sequence
MSEEDKAKKLENLLKLLQLNNDDTSKFTQEQKKAMKDHKFWRTQPVKDFDEKVVEEGPID
KPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFF
NWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSK
RLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDG
HTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIG
EESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQ
FKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFL
NFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Download sequence
Identical sequences N1P6S8 P14743
YLR195C 2p6e.A 2p6e.B 2p6e.C 2p6e.D 2p6e.E 2p6e.F 2p6f.A 2p6f.B 2p6f.C 2p6f.D 2p6f.E 2p6f.F 2p6g.A 2p6g.B 2p6g.C 2p6g.D 2p6g.E 2p6g.F YLR195C 4932.YLR195C YLR195C YLR195C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]