SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR208W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR208W
Domain Number 1 Region: 12-288
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.34e-51
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2

Protein sequence

External link(s) Locus: YLR208W   Protein: S000004198
Sequence length 297
Comment SEC13 SGDID:S000004198, Chr XII from 559553-560446, Verified ORF, "Component of both the Nup84 nuclear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the formation of ER to Golgi transport vesicles"
Sequence
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Download sequence
Identical sequences A7A196 B3RH97 B5VNC6 C7GIT7 C8ZDH2 E7KFP1 E7KRU1 E7LXQ0 E7NKR3 G2WJ38 N1NZT9 Q04491 W7PFW5 W7QV63
YLR208W SCRT_04166 tr|A7A196|A7A196_YEAS7 YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W 4932.YLR208W 2pm6.B 2pm6.D 3iko.A 3iko.D 3iko.G 3mzk.A 3mzk.D 3mzl.A 3mzl.C 3mzl.E 3mzl.G 4bzk.B YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]