SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR208W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR208W
Domain Number 1 Region: 12-288
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.34e-51
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
endosome 1.351 9.77
cytoplasmic vesicle part 1.417 9.77
endosome membrane 1.934 9.77
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67

Protein sequence

External link(s) Locus: YLR208W   Protein: S000004198
Sequence length 297
Comment SEC13 SGDID:S000004198, Chr XII from 559553-560446, Verified ORF, "Component of both the Nup84 nuclear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the formation of ER to Golgi transport vesicles"
Sequence
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Download sequence
Identical sequences A0A0L8VL68 A7A196 B3RH97 B5VNC6 C7GIT7 C8ZDH2 E7KFP1 E7KRU1 E7LXQ0 E7NKR3 G2WJ38 N1NZT9 Q04491
YLR208W YLR208W YLR208W YLR208W YLR208W tr|A7A196|A7A196_YEAS7 YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W 2pm6.B 2pm6.D 3iko.A 3iko.D 3iko.G 3mzk.A 3mzk.D 3mzl.A 3mzl.C 3mzl.E 3mzl.G 4bzk.B 4xmm.A 4xmn.A YLR208W YLR208W YLR208W SCRT_04166 YLR208W 4932.YLR208W YLR208W YLR208W YLR208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]