SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR208W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR208W
Domain Number 1 Region: 12-288
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.34e-51
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YLR208W   Protein: S000004198
Sequence length 297
Comment SEC13 SGDID:S000004198, Chr XII from 559553-560446, Verified ORF, "Component of both the Nup84 nuclear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the formation of ER to Golgi transport vesicles"
Sequence
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Download sequence
Identical sequences A7A196 B3RH97 B5VNC6 C7GIT7 C8ZDH2 E7KFP1 E7KRU1 E7LXQ0 E7NKR3 G2WJ38 N1NZT9 Q04491 W7PFW5 W7QV63
YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W tr|A7A196|A7A196_YEAS7 YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W 2pm6.B 2pm6.D 3iko.A 3iko.D 3iko.G 3mzk.A 3mzk.D 3mzl.A 3mzl.C 3mzl.E 3mzl.G 4bzk.B SCRT_04166 4932.YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]