SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR222C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR222C
Domain Number 1 Region: 381-644
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.4e-61
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 23-322
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.61e-39
Family WD40-repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  YLR222C
Domain Number - Region: 622-689
Classification Level Classification E-value
Superfamily YgfB-like 0.0902
Family YgfB-like 0.012
Further Details:      
 

Protein sequence

External link(s) Locus: YLR222C   Protein: S000004212
Sequence length 817
Comment UTP13 SGDID:S000004212, Chr XII from 581773-579320, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNED
EQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG
GTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKR
KCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVN
QQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNS
QMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSP
SLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNEN
SCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQII
KVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVS
FCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIK
IWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAK
LQVEQEQSLQNYMSKGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIF
NEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVK
IVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF
Download sequence
Identical sequences B3RHB0 C7GIV0 Q05946
YLR222C 4932.YLR222C YLR222C YLR222C SCRT_04179 YLR222C YLR222C YR294

Jump to [ Top of page · Domain architecture · Domain assignment details ]