SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR222C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR222C
Domain Number 1 Region: 381-644
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.4e-61
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 23-322
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.61e-39
Family WD40-repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  YLR222C
Domain Number - Region: 622-689
Classification Level Classification E-value
Superfamily YgfB-like 0.0902
Family YgfB-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YLR222C   Protein: S000004212
Sequence length 817
Comment UTP13 SGDID:S000004212, Chr XII from 581773-579320, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNED
EQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG
GTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKR
KCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVN
QQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNS
QMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSP
SLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNEN
SCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQII
KVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVS
FCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIK
IWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAK
LQVEQEQSLQNYMSKGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIF
NEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVK
IVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF
Download sequence
Identical sequences B3RHB0 C7GIV0 N1P6W1 Q05946 W7PD19
YLR222C YLR222C YLR222C YR294 SCRT_04179 YLR222C 4932.YLR222C YLR222C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]