SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR222C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR222C
Domain Number 1 Region: 381-644
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.4e-61
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 23-322
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.61e-39
Family WD40-repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  YLR222C
Domain Number - Region: 622-689
Classification Level Classification E-value
Superfamily YgfB-like 0.0902
Family YgfB-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
actin polymerization or depolymerization 2.157 15.64
microtubule-based process 1.533 14.77
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78

Protein sequence

External link(s) Locus: YLR222C   Protein: S000004212
Sequence length 817
Comment UTP13 SGDID:S000004212, Chr XII from 581773-579320, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNED
EQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG
GTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKR
KCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVN
QQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNS
QMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSP
SLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNEN
SCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQII
KVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVS
FCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIK
IWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAK
LQVEQEQSLQNYMSKGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIF
NEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVK
IVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF
Download sequence
Identical sequences B3RHB0 C7GIV0 N1P6W1 Q05946 W7PD19
YLR222C YLR222C YLR222C 4932.YLR222C YLR222C YR294 YLR222C SCRT_04179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]