SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR249W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR249W
Domain Number 1 Region: 6-214,249-427,567-640,715-800,910-968,1015-1035
Classification Level Classification E-value
Superfamily ARM repeat 1.84e-49
Family Armadillo repeat 0.083
Further Details:      
 
Domain Number 2 Region: 436-615
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.65e-37
Family ABC transporter ATPase domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 669-729,830-975
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.76e-32
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YLR249W   Protein: S000004239
Sequence length 1044
Comment YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor 3, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP"
Sequence
MSDSQQSIKVLEELFQKLSVATADNRHEIASEVASFLNGNIIEHDVPEHFFGELAKGIKD
KKTAANAMQAVAHIANQSNLSPSVEPYIVQLVPAICTNAGNKDKEIQSVASETLISIVNA
VNPVAIKALLPHLTNAIVETNKWQEKIAILAAISAMVDAAKDQVALRMPELIPVLSETMW
DTKKEVKAAATAAMTKATETVDNKDIERFIPSLIQCIADPTEVPETVHLLGATTFVAEVT
PATLSIMVPLLSRGLNERETGIKRKSAVIIDNMCKLVEDPQVIAPFLGKLLPGLKSNFAT
IADPEAREVTLRALKTLRRVGNVGEDDAIPEVSHAGDVSTTLQVVNELLKDETVAPRFKI
VVEYIAAIGADLIDERIIDQQAWFTHITPYMTIFLHEKKAKDILDEFRKRAVDNIPVGPN
FDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ
VDGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMP
ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDS
VFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLEGVK
TKQKAIVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLP
TSGEVYTHENCRIAYIKQHAFAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINEND
AEAMNKIFKIEGTPRRIAGIHSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWI
PRGELVESHSKMVAEVDMKEALASGQFRPLTRKEIEEHCSMLGLDPEIVSHSRIRGLSGG
QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLT
EEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKIAGGKKKKKLSSAELR
KKKKERMKKKKELGDAYVSSDEEF
Download sequence
Identical sequences E7NKT6 G2WJ75 N1NYG5 P16521
YLR249W 4932.YLR249W YLR249W YLR249W YLR249W YLR249W

Jump to [ Top of page · Domain architecture · Domain assignment details ]