SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR249W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR249W
Domain Number 1 Region: 6-214,249-427,567-640,715-800,910-968,1015-1035
Classification Level Classification E-value
Superfamily ARM repeat 1.84e-49
Family Armadillo repeat 0.083
Further Details:      
 
Domain Number 2 Region: 436-615
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.65e-37
Family ABC transporter ATPase domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 669-729,830-975
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.76e-32
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
membrane coat 2.107 28.72
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
trans-Golgi network 1.798 19.27
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36

Protein sequence

External link(s) Locus: YLR249W   Protein: S000004239
Sequence length 1044
Comment YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor 3, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP"
Sequence
MSDSQQSIKVLEELFQKLSVATADNRHEIASEVASFLNGNIIEHDVPEHFFGELAKGIKD
KKTAANAMQAVAHIANQSNLSPSVEPYIVQLVPAICTNAGNKDKEIQSVASETLISIVNA
VNPVAIKALLPHLTNAIVETNKWQEKIAILAAISAMVDAAKDQVALRMPELIPVLSETMW
DTKKEVKAAATAAMTKATETVDNKDIERFIPSLIQCIADPTEVPETVHLLGATTFVAEVT
PATLSIMVPLLSRGLNERETGIKRKSAVIIDNMCKLVEDPQVIAPFLGKLLPGLKSNFAT
IADPEAREVTLRALKTLRRVGNVGEDDAIPEVSHAGDVSTTLQVVNELLKDETVAPRFKI
VVEYIAAIGADLIDERIIDQQAWFTHITPYMTIFLHEKKAKDILDEFRKRAVDNIPVGPN
FDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ
VDGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMP
ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDS
VFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLEGVK
TKQKAIVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLP
TSGEVYTHENCRIAYIKQHAFAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINEND
AEAMNKIFKIEGTPRRIAGIHSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWI
PRGELVESHSKMVAEVDMKEALASGQFRPLTRKEIEEHCSMLGLDPEIVSHSRIRGLSGG
QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLT
EEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKIAGGKKKKKLSSAELR
KKKKERMKKKKELGDAYVSSDEEF
Download sequence
Identical sequences E7NKT6 G2WJ75 N1NYG5 P16521
YLR249W 4932.YLR249W YLR249W YLR249W YLR249W YLR249W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]